GET /api/protein/UniProt/A0A212I2J7/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A212I2J7",
"id": "A0A212I2J7_9ENTR",
"source_organism": {
"taxId": "200446",
"scientificName": "uncultured Citrobacter sp.",
"fullName": "uncultured Citrobacter sp."
},
"name": "Phosphoglycolate phosphatase",
"description": [
"Specifically catalyzes the dephosphorylation of 2-phosphoglycolate. Is involved in the dissimilation of the intracellular 2-phosphoglycolate formed during the DNA repair of 3'-phosphoglycolate ends, a major class of DNA lesions induced by oxidative stress"
],
"length": 252,
"sequence": "MDKFQDIRGAAFDLDGTLVDSAPGLAAAVDMALYALELPVAGEERVITWIGNGADVLMERALAWSRQERATLRKTMGKPPVDDDIPAEEQVRILRKLFDRYYGDVAEEGTFLFPDVADTLGALHAKGLPLGLVTNKPTPFVAPLLEALDIAKYFSVVIGGDDVQNKKPHPDPLLLVASKLGIKPEQMLFVGDSRNDIQAAKAAGCPSVGLTYGYNYGESIALSQPDVIYDRINELLPALGLPHSENQESKND",
"proteome": null,
"gene": "gph",
"go_terms": [
{
"identifier": "GO:0008967",
"name": "phosphoglycolate phosphatase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0005975",
"name": "carbohydrate metabolic process",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "7abaa5ff36bb15cd07cb434c7298e4a841feb5fc",
"counters": {
"domain_architectures": 179620,
"entries": 23,
"isoforms": 0,
"proteomes": 0,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 1,
"pfam": 1,
"cathgene3d": 2,
"cdd": 1,
"ncbifam": 6,
"panther": 1,
"sfld": 3,
"hamap": 1,
"prints": 1,
"interpro": 6
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 179620
}
}
}