HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A1Z1SX74",
"id": "A0A1Z1SX74_PROMI",
"source_organism": {
"taxId": "584",
"scientificName": "Proteus mirabilis",
"fullName": "Proteus mirabilis"
},
"name": "Holliday junction branch migration complex subunit RuvA",
"description": [
"The RuvA-RuvB-RuvC complex processes Holliday junction (HJ) DNA during genetic recombination and DNA repair, while the RuvA-RuvB complex plays an important role in the rescue of blocked DNA replication forks via replication fork reversal (RFR). RuvA specifically binds to HJ cruciform DNA, conferring on it an open structure. The RuvB hexamer acts as an ATP-dependent pump, pulling dsDNA into and through the RuvAB complex. HJ branch migration allows RuvC to scan DNA until it finds its consensus sequence, where it cleaves and resolves the cruciform DNA"
],
"length": 207,
"sequence": "MIGRIRGVILEKQPPVVLIEAGNGVGYEINMPMTCFYELPDIGQEAIIYTQFIVREDAQLLYGFNQKQERALFRELIKVNGVGPKLALAILSGMSARQFVTAIENESISSLVKLPGVGKKTAERLVVEMKDRFKGLNGDLFEQNGDIELPASASSKAPSAADIEAEASAALIALGYKPQEAAKMISRVATAGADSETLIKEALRAAI",
"proteome": null,
"gene": "ruvA",
"go_terms": [
{
"identifier": "GO:0005524",
"name": "ATP binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0009378",
"name": "four-way junction helicase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006281",
"name": "DNA repair",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0006310",
"name": "DNA recombination",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0003677",
"name": "DNA binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0009379",
"name": "Holliday junction helicase complex",
"category": {
"code": "C",
"name": "cellular_component"
}
},
{
"identifier": "GO:0003678",
"name": "DNA helicase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "4efa3825d88489eb7bd0d25d6929d75b09132c62",
"counters": {
"domain_architectures": 23598,
"entries": 21,
"isoforms": 0,
"proteomes": 0,
"sets": 4,
"structures": 0,
"taxa": 1,
"dbEntries": {
"pfam": 3,
"ssf": 3,
"cathgene3d": 3,
"smart": 1,
"cdd": 1,
"ncbifam": 1,
"hamap": 1,
"interpro": 8
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 23598
}
}
}