General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A1Y1C2V2",
        "id": "A0A1Y1C2V2_9ADEN",
        "source_organism": {
            "taxId": "651580",
            "scientificName": "Human adenovirus 54",
            "fullName": "Human adenovirus 54"
        },
        "name": "Early E1A protein",
        "description": [
            "Plays a role in viral genome replication by driving entry of quiescent cells into the cell cycle"
        ],
        "length": 253,
        "sequence": "MRHLHLLSSTVPIDMAALLLEDYVNTILEDELHLSPFELGPTLQDLYDLEVNAQENDPNEEAVNLIFPESMILQADIASEAVPTSVYTPTLPPIPKLEEEDKLDLRCYEEGFPPSDSEDERGEQSMAIISDYACVVVENHFVLDNPKVPGQGCKSCQYHREQTGDPNASCALCYMKMSFSFIYSPVSEDESSPLEEDHPSPPDLTNDTPLQVRKPTPVRPSGERRAAVYKIEDLLQDVGGNEPLNLSLKRPRN",
        "proteome": null,
        "gene": "E1A",
        "go_terms": [
            {
                "identifier": "GO:0006355",
                "name": "regulation of DNA-templated transcription",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0044003",
                "name": "symbiont-mediated perturbation of host process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": false,
        "in_bfvd": false,
        "ida_accession": "aa9de53927f3141903272837a9ae8f01e65ef0f7",
        "counters": {
            "domain_architectures": 664,
            "entries": 3,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "pfam": 1,
                "pirsf": 1,
                "interpro": 1
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 664
        }
    }
}