GET /api/protein/UniProt/A0A1X1FYS3/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A1X1FYS3",
        "id": "A0A1X1FYS3_STROR",
        "source_organism": {
            "taxId": "1077464",
            "scientificName": "Streptococcus oralis subsp. tigurinus",
            "fullName": "Streptococcus oralis subsp. tigurinus"
        },
        "name": "Epoxyqueuosine reductase QueH",
        "description": [
            "Catalyzes the conversion of epoxyqueuosine (oQ) to queuosine (Q), which is a hypermodified base found in the wobble positions of tRNA(Asp), tRNA(Asn), tRNA(His) and tRNA(Tyr)"
        ],
        "length": 255,
        "sequence": "MIDVEEILSKMNPNQKINYDRVMQKMVQVWEKNEQRPTILMHVCCAPCSTYTLEYLTKYADVTIYFANSNIHPKAEYHKRAYVTKKFVSDFNERTGNTVQYLEAPYEPNEYRKLVRGLEEEPEGGDRCKVCFDYRLDKTAQVAMDLGFDYFGSALTISPHKNSQTINSIGIDVQKIYTTHYLPSDFKKNQGYKRSVEMCEEYDIYRQCYCGCVYAAQAQNIDLVQIKKDATAFLLDKDVEKDYSHIKFTVTKLDI",
        "proteome": null,
        "gene": "queH",
        "go_terms": null,
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "d268808aa77087735756d236f36856525794a1c1",
        "counters": {
            "domain_architectures": 5541,
            "entries": 4,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "panther": 1,
                "pfam": 1,
                "hamap": 1,
                "interpro": 1
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 5541
        }
    }
}