General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A1X0REG9",
        "id": "A0A1X0REG9_RHIZD",
        "source_organism": {
            "taxId": "86635",
            "scientificName": "Rhizopus microsporus var. microsporus",
            "fullName": "Rhizopus microsporus var. microsporus"
        },
        "name": "Squalene monooxygenase",
        "description": [
            "Catalyzes the stereospecific oxidation of squalene to (S)-2,3-epoxysqualene, and is considered to be a rate-limiting enzyme in steroid biosynthesis"
        ],
        "length": 459,
        "sequence": "MSQPVNEYDLIIVGAGVVGCAAAKAFGEDGRKVLLLERDLSEPDRIVGELMQPGGIQALKALGMEDCTEGIDGIACYGYGVYRDGESVELPYSMDSSSGKQFRGIAFHHGRFIQKLRQSAKVAPNVTVKEGTVTRLLDQDERVIGVASYDKTKDKEEVYYAPLTLVADGIFSKFRKAFTDSQTKVLSHFVGFLLHDFELPYAQKAFVVIAKPSPILMYQIDPHDTRILVDVPGEHLPKGDDLKKYILDVVVPQLPEYMQDKFKEALETERLRPMPSGFLPPSINQCPGTILLGDALNVRSPLTGGGMTVALYDVLTCRDLLSRENVTSFTETDLVLQAMDAFHWKRKKYSACINVLAMALYSVFAADDNENLMTVQKGCFEYFKLGNECTQGPVDLVAGVNPSPLSLIYHFISVVLYAIYIMFAKGNAKDIPKNVARAISVLYTGYVTLFPFLWGEFKG",
        "proteome": null,
        "gene": "BCV72DRAFT_21307",
        "go_terms": [
            {
                "identifier": "GO:0004506",
                "name": "squalene monooxygenase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0016126",
                "name": "sterol biosynthetic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0050660",
                "name": "flavin adenine dinucleotide binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0016020",
                "name": "membrane",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "7480fefb765e2b921571ded7344e6e5d708381d6",
        "counters": {
            "domain_architectures": 2362,
            "entries": 8,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "panther": 1,
                "pfam": 1,
                "prints": 1,
                "interpro": 3
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 2362
        }
    }
}