General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A1W6CC87",
        "id": "A0A1W6CC87_COFAR",
        "source_organism": {
            "taxId": "13443",
            "scientificName": "Coffea arabica",
            "fullName": "Coffea arabica (Arabian coffee)"
        },
        "name": "Large ribosomal subunit protein uL22c",
        "description": [
            "The globular domain of the protein is located near the polypeptide exit tunnel on the outside of the subunit, while an extended beta-hairpin is found that lines the wall of the exit tunnel in the center of the 70S ribosome",
            "This protein binds specifically to 23S rRNA"
        ],
        "length": 155,
        "sequence": "MLKKKKTEVYALGQHISMSADKARRVIDQIRGRSYEETLIILELMPYRACYPIFKLVYSAAANASYNMSSNDANLLISKAEVNEGTTIKKFKPRARGRSYPIKRPTCHITIVMKDISLDDEYVKINSLKKPRWKNKHTAMVYHDMYSSGGVWDKK",
        "proteome": "UP001652660",
        "gene": "rpl22",
        "go_terms": [
            {
                "identifier": "GO:0003735",
                "name": "structural constituent of ribosome",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006412",
                "name": "translation",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0005840",
                "name": "ribosome",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            },
            {
                "identifier": "GO:0015934",
                "name": "large ribosomal subunit",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "c33fece06d00a2e6902b8b7efbe7e3e414e72fb4",
        "counters": {
            "domain_architectures": 49125,
            "entries": 13,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "cdd": 1,
                "pfam": 1,
                "panther": 1,
                "hamap": 1,
                "ncbifam": 1,
                "prosite": 1,
                "interpro": 5
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 49125
        }
    }
}