HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A1W4XN90",
"id": "A0A1W4XN90_AGRPL",
"source_organism": {
"taxId": "224129",
"scientificName": "Agrilus planipennis",
"fullName": "Agrilus planipennis (Emerald ash borer)"
},
"name": "S-methyl-5'-thioadenosine phosphorylase",
"description": [
"Catalyzes the reversible phosphorylation of S-methyl-5'-thioadenosine (MTA) to adenine and 5-methylthioribose-1-phosphate. Involved in the breakdown of MTA, a major by-product of polyamine biosynthesis. Responsible for the first step in the methionine salvage pathway after MTA has been generated from S-adenosylmethionine. Has broad substrate specificity with 6-aminopurine nucleosides as preferred substrates"
],
"length": 276,
"sequence": "MFPVKVGIIGGSGLDNPDIFKSRSEKRVTTIFGDPSDILIEGTLGDVPCVLLARHGRKHNINPTNVNYRANIWALKEIGCTHVIVSAAVGSLLEDFRPGEFVILNNFIDRTTKRFSTFYDGQSKSPKGVTHIPMEPAFCERTRQIVIDAGQSLGLNVHDEGTIVVIEGPRFSTKAESLMYRQWGGHVVGMTTVPEVILAKEAGLCYSAIALITDYDCWKADFSAVNVEKVEETFKENVKKVTDLIIEVVTRIGKDNWDDTIKEKRDTVTKANMMRE",
"proteome": "UP000192223",
"gene": "LOC108743255",
"go_terms": [
{
"identifier": "GO:0003824",
"name": "catalytic activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0009116",
"name": "nucleoside metabolic process",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0017061",
"name": "S-methyl-5-thioadenosine phosphorylase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "27552274e8941821ae0d138350daef5fe3adde72",
"counters": {
"domain_architectures": 85785,
"entries": 10,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 1,
"cathgene3d": 1,
"pfam": 1,
"cdd": 1,
"panther": 1,
"hamap": 1,
"ncbifam": 1,
"interpro": 3
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 85785
}
}
}