General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A1W4X4U2",
        "id": "A0A1W4X4U2_AGRPL",
        "source_organism": {
            "taxId": "224129",
            "scientificName": "Agrilus planipennis",
            "fullName": "Agrilus planipennis (Emerald ash borer)"
        },
        "name": "dTCF",
        "description": [
            "Segment polarity protein. Functions together with arm to transduce the Wingless (Wg) signal in embryos and in developing adult tissues. Acts as a transcriptional activator, but in the absence of arm, it binds to gro and acts as a transcriptional repressor of wg-responsive genes"
        ],
        "length": 338,
        "sequence": "MLTRRRKTPDGNNMDSGDLLPTVINNGFERGLSLEEFALQFKIMIIDRENRRRRAILSLTRPPMYPFSAGQYPYPMLSPDMSQVAASWVPYQTRHTPSVYPLSPGTGFRSPYPSTLPISTSSLPTDLYRFSPTGLIPPHPGLSPHGPPLGSHPAIVTPGPKQELPDLNHRYHRNQIDQKNNIGDTKNSQDSNNSGEKKKPHIKKPLNAFMLYMKEMRAKVVAECTLKESAAINQILGRRWHALGREEQAKYYELARRERQLHMQLYPDWSSRANATSRGKKRKRKQDPNDGGSNPHHTHSLLNLFMHTNHQSHHHYFSTYLSHCNIFVYSWRCPAVPP",
        "proteome": "UP000192223",
        "gene": "LOC108741021",
        "go_terms": [
            {
                "identifier": "GO:0016055",
                "name": "Wnt signaling pathway",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "ba71805ac3750d134530e8b8d14e816f9d4dbece",
        "counters": {
            "domain_architectures": 54587,
            "entries": 10,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "cathgene3d": 1,
                "smart": 1,
                "cdd": 1,
                "pfam": 1,
                "profile": 1,
                "panther": 1,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 54587
        }
    }
}