General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A1W2TL32",
        "id": "A0A1W2TL32_ROSNE",
        "source_organism": {
            "taxId": "77044",
            "scientificName": "Rosellinia necatrix",
            "fullName": "Rosellinia necatrix (White root-rot fungus)"
        },
        "name": "Cytochrome c",
        "description": [
            "Electron carrier protein. The oxidized form of the cytochrome c heme group can accept an electron from the heme group of the cytochrome c1 subunit of cytochrome reductase. Cytochrome c then transfers this electron to the cytochrome oxidase complex, the final protein carrier in the mitochondrial electron-transport chain"
        ],
        "length": 108,
        "sequence": "MGFSAGDLKKGEKLFTTRCAQCHTLKEGEGNKVGPALHGLFGRKTGSVEGYAYTDANKQKGIEWTEDTLFTYLENPKKYIPGTKMAFGGLKKDKDRNDLISYLKKETA",
        "proteome": "UP000054516",
        "gene": "SAMD00023353_3400880",
        "go_terms": [
            {
                "identifier": "GO:0009055",
                "name": "electron transfer activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0020037",
                "name": "heme binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "190ccab1ff44fe1a3b1be561b80e69bb85fa539b",
        "counters": {
            "domain_architectures": 48058,
            "entries": 9,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "profile": 1,
                "pfam": 1,
                "panther": 1,
                "prints": 1,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 48058
        }
    }
}