General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A1V0QG76",
        "id": "A0A1V0QG76_CNPV",
        "source_organism": {
            "taxId": "1974596",
            "scientificName": "Shearwaterpox virus",
            "fullName": "Shearwaterpox virus"
        },
        "name": "Entry-fusion complex protein OPG086",
        "description": [
            "Component of the entry fusion complex (EFC), which consists of 11 proteins. During cell infection, this complex mediates entry of the virion core into the host cytoplasm by a two-step mechanism consisting of lipid mixing of the viral and cellular membranes and subsequent pore formation"
        ],
        "length": 102,
        "sequence": "MTLLIFLLVLFLLLCYFLNFKRTNKMDIGINPIKKTPWSGNDHLFVSTLFHNNNKYVTGPMKLNYDPEKKGVVIEFKNTKYTYDLTDFSDARKLIPTLLLSK",
        "proteome": null,
        "gene": "SWPV2-101",
        "go_terms": null,
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": false,
        "in_bfvd": false,
        "ida_accession": "8b0304132b1be3caf0378015ac0cc9b1f9d5c71b",
        "counters": {
            "domain_architectures": 113,
            "entries": 2,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "pfam": 1,
                "interpro": 1
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 113
        }
    }
}