General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A1U8CWA7",
        "id": "A0A1U8CWA7_MESAU",
        "source_organism": {
            "taxId": "10036",
            "scientificName": "Mesocricetus auratus",
            "fullName": "Mesocricetus auratus (Golden hamster)"
        },
        "name": "Mitochondrial outer membrane protein SLC25A46",
        "description": [
            "Transmembrane protein of the mitochondrial outer membrane that controls mitochondrial organization. May regulate the assembly of the MICOS (mitochondrial contact site and cristae organizing system) complex which is essential to the biogenesis and dynamics of mitochondrial cristae, the inwards folds of the inner mitochondrial membrane. Through its interaction with the EMC (endoplasmic reticulum membrane protein complex), could regulate mitochondrial lipid homeostasis and thereby mitochondrial fission"
        ],
        "length": 400,
        "sequence": "MHPRRPDGFDGLGYRGGVRDDPAFGVPFHARPFGSGSDPGPWVTTPPDIPGSRNLHWGEKSPAYGVPSAPATLEGPAAEEPFPAGGDVPRPGPSSEQLNRFAGFGIGLASLFTENVLAHPCIVIRRQCQVNYHGRHYHLTPFTVINIMYSFNKTQGPRALWKGMGSTFIVQGVTLGAEGIISEFTPLPSLTYVVAMPFYSASLIETVQSEIIRDNTGILECIKEGIGRAIGLGVPHSKRLLPLLSLIFPTVLHGALHYIISSIIQKIVLLLLKRKTCDGHLAESTSPMQSMLDAYFPELIANFAASLCSDVILYPLETVLHRLHVQGTRTIIDNTDLGYEVLPINTQYEGMRDCINTIKQEEGVLGFYKGFGAVIIQYTLHAAILQITKVIYSTLLQNSI",
        "proteome": "UP000886700",
        "gene": "Slc25a46",
        "go_terms": [
            {
                "identifier": "GO:0090149",
                "name": "mitochondrial membrane fission",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0005741",
                "name": "mitochondrial outer membrane",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "9a514267c6491c9924c6aeac63a5819745aaee5f",
        "counters": {
            "domain_architectures": 29840,
            "entries": 8,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "pfam": 1,
                "profile": 1,
                "panther": 1,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 29840
        }
    }
}