HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A1U7V3N7",
"id": "A0A1U7V3N7_CARSF",
"source_organism": {
"taxId": "1868482",
"scientificName": "Carlito syrichta",
"fullName": "Carlito syrichta (Philippine tarsier)"
},
"name": "Vasopressin V1a receptor",
"description": [
"Receptor for arginine vasopressin. The activity of this receptor is mediated by G proteins which activate a phosphatidyl-inositol-calcium second messenger system"
],
"length": 320,
"sequence": "AVAFFQVLPQLCWDITYRFRGPDWLCRVVKHLQVFGMFASAYMLVAMTADRYIAVCHPLKTLQQPARRSHLMIAAAWLLSLVLSAPQYLVFSMVEVNNVTKARDCWATFVQPWGSRAYVTWMTGGIFVAPVAVLATCYGFICCSIWRNXXXXXXXXXXXGADAAGDALGNGLLVAPCVSSVKTISRAKIRTVKMTLVIVTAYVVCWAPFFVIQMWSVWDARSAWTDSENPTITITALLASLNSCCNPWIYMFFSGHLLQDCVQSFPCCQSMKENLNKEDTDSMSRRQTFYSNNRSLTNSTSMWKDSPKSSKSIKFIPVST",
"proteome": "UP000189704",
"gene": "AVPR1A",
"go_terms": [
{
"identifier": "GO:0016020",
"name": "membrane",
"category": {
"code": "C",
"name": "cellular_component"
}
},
{
"identifier": "GO:0004930",
"name": "G protein-coupled receptor activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0007186",
"name": "G protein-coupled receptor signaling pathway",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0005000",
"name": "vasopressin receptor activity",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": true,
"in_alphafold": false,
"in_bfvd": false,
"ida_accession": "ab5c1a604bf1fa15d6dfc04bb7ba881168fe7cb6",
"counters": {
"domain_architectures": 986,
"entries": 16,
"isoforms": 0,
"proteomes": 1,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"profile": 1,
"cathgene3d": 1,
"ssf": 1,
"pfam": 2,
"smart": 1,
"panther": 1,
"prosite": 1,
"prints": 3,
"interpro": 5
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 986
}
}
}