GET /api/protein/UniProt/A0A1U7TYT9/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 109.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A1U7TYT9",
        "id": "A0A1U7TYT9_CARSF",
        "source_organism": {
            "taxId": "1868482",
            "scientificName": "Carlito syrichta",
            "fullName": "Carlito syrichta (Philippine tarsier)"
        },
        "name": "Lethal(3)malignant brain tumor-like protein 1",
        "description": [
            "Polycomb group (PcG) protein that specifically recognizes and binds mono- and dimethyllysine residues on target proteins, thereby acting as a 'reader' of a network of post-translational modifications. PcG proteins maintain the transcriptionally repressive state of genes: acts as a chromatin compaction factor by recognizing and binding mono- and dimethylated histone H1b/H1-4 at 'Lys-26' (H1bK26me1 and H1bK26me2) and histone H4 at 'Lys-20' (H4K20me1 and H4K20me2), leading to condense chromatin and repress transcription. Recognizes and binds p53/TP53 monomethylated at 'Lys-382', leading to repress p53/TP53-target genes. Also recognizes and binds RB1/RB monomethylated at 'Lys-860'. Participates in the ETV6-mediated repression. Probably plays a role in cell proliferation. Overexpression induces multinucleated cells, suggesting that it is required to accomplish normal mitosis"
        ],
        "length": 873,
        "sequence": "MEGHAEMEMLRTLKGASTGEVSVHLVARDSPGSGPHLPATAFIIPASSASLGLSSSALDVSCFPREPIHVGAPEQVVGSEPVTATVLPQLSAGPSASSSASTVRLLEWTEAEAPPPGSGLRFRISEYTPLNMAGMEQPASPELRREGVSEYEDGGAPSGDGDVGTQQPEDLPQNPPEDPSQDPPEDDATCQCQACGPQQAAGPDLGSSNDGCPQLFQERSVIVENSSGCASTSELKPMKKRKRREYQSPSEEESEPEAMEKQEEGKDPEEPPTASTPESEEWSSSQPATGEKKDGWSWEAYLEEQKAITAPVSLFQDSQSVTHHKNGFKLGMKLEGIDPQHPSMYFILTVAEVCGYRLRLHFDGYSECHDFWVNANSPDIHPAGWFEKTGHKLQPPKGYKEEEFSWSQYLRSTRAQAAPKHLFVSQSHSPPPLGFQVGMKLEAVDRMNPSLVCVASVTDVVDSRFLVHFDNWDDTYDYWCDPSSPYIHPVGWCQKQGKPLTPPQDYPDPDSFCWEKYLEETGASAVPAWAFKVRPPHSFLVNMKLEAVDRRSPALIRVASVEDVEDHRIKLHFDGWSHSYDFWIDADHPDIHPAGWCSKTGHPLQPPLRPREPSSASPGGCPPLSYRNLPHSKTSKYSFHHRKCPTPGCDGSGHVTGKFTAHHCLSGCPLAERNQSRVKAELSDSETSARKRNLSGFSPRKKPRHHGRIGRPPKFRKIPQEGFQTLTPDVVHQSLFMSALSAHPDRSLSVCWEQHCKLLPGVAGISASTVAKWTIDEVFGFVQNLTGCEDQARLFKDEARLVRMTHISGKNLVWTMAQLGYFVCSDHLQEGKDIXETAFHSLLCSLPSSLFAKLSFLGDSQEIKMLFFSSNPI",
        "proteome": "UP000189704",
        "gene": "L3MBTL1",
        "go_terms": [
            {
                "identifier": "GO:0006355",
                "name": "regulation of DNA-templated transcription",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0005634",
                "name": "nucleus",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            },
            {
                "identifier": "GO:0008270",
                "name": "zinc ion binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 4,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": false,
        "ida_accession": "a3bfffeca780c509fc4d20700e40199a1fd7ffd5",
        "counters": {
            "domain_architectures": 800,
            "entries": 19,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "smart": 1,
                "profile": 2,
                "cathgene3d": 2,
                "cdd": 3,
                "ssf": 2,
                "pfam": 2,
                "panther": 1,
                "interpro": 6
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 800
        }
    }
}