HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 109.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A1U7TYT9",
"id": "A0A1U7TYT9_CARSF",
"source_organism": {
"taxId": "1868482",
"scientificName": "Carlito syrichta",
"fullName": "Carlito syrichta (Philippine tarsier)"
},
"name": "Lethal(3)malignant brain tumor-like protein 1",
"description": [
"Polycomb group (PcG) protein that specifically recognizes and binds mono- and dimethyllysine residues on target proteins, thereby acting as a 'reader' of a network of post-translational modifications. PcG proteins maintain the transcriptionally repressive state of genes: acts as a chromatin compaction factor by recognizing and binding mono- and dimethylated histone H1b/H1-4 at 'Lys-26' (H1bK26me1 and H1bK26me2) and histone H4 at 'Lys-20' (H4K20me1 and H4K20me2), leading to condense chromatin and repress transcription. Recognizes and binds p53/TP53 monomethylated at 'Lys-382', leading to repress p53/TP53-target genes. Also recognizes and binds RB1/RB monomethylated at 'Lys-860'. Participates in the ETV6-mediated repression. Probably plays a role in cell proliferation. Overexpression induces multinucleated cells, suggesting that it is required to accomplish normal mitosis"
],
"length": 873,
"sequence": "MEGHAEMEMLRTLKGASTGEVSVHLVARDSPGSGPHLPATAFIIPASSASLGLSSSALDVSCFPREPIHVGAPEQVVGSEPVTATVLPQLSAGPSASSSASTVRLLEWTEAEAPPPGSGLRFRISEYTPLNMAGMEQPASPELRREGVSEYEDGGAPSGDGDVGTQQPEDLPQNPPEDPSQDPPEDDATCQCQACGPQQAAGPDLGSSNDGCPQLFQERSVIVENSSGCASTSELKPMKKRKRREYQSPSEEESEPEAMEKQEEGKDPEEPPTASTPESEEWSSSQPATGEKKDGWSWEAYLEEQKAITAPVSLFQDSQSVTHHKNGFKLGMKLEGIDPQHPSMYFILTVAEVCGYRLRLHFDGYSECHDFWVNANSPDIHPAGWFEKTGHKLQPPKGYKEEEFSWSQYLRSTRAQAAPKHLFVSQSHSPPPLGFQVGMKLEAVDRMNPSLVCVASVTDVVDSRFLVHFDNWDDTYDYWCDPSSPYIHPVGWCQKQGKPLTPPQDYPDPDSFCWEKYLEETGASAVPAWAFKVRPPHSFLVNMKLEAVDRRSPALIRVASVEDVEDHRIKLHFDGWSHSYDFWIDADHPDIHPAGWCSKTGHPLQPPLRPREPSSASPGGCPPLSYRNLPHSKTSKYSFHHRKCPTPGCDGSGHVTGKFTAHHCLSGCPLAERNQSRVKAELSDSETSARKRNLSGFSPRKKPRHHGRIGRPPKFRKIPQEGFQTLTPDVVHQSLFMSALSAHPDRSLSVCWEQHCKLLPGVAGISASTVAKWTIDEVFGFVQNLTGCEDQARLFKDEARLVRMTHISGKNLVWTMAQLGYFVCSDHLQEGKDIXETAFHSLLCSLPSSLFAKLSFLGDSQEIKMLFFSSNPI",
"proteome": "UP000189704",
"gene": "L3MBTL1",
"go_terms": [
{
"identifier": "GO:0006355",
"name": "regulation of DNA-templated transcription",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0005634",
"name": "nucleus",
"category": {
"code": "C",
"name": "cellular_component"
}
},
{
"identifier": "GO:0008270",
"name": "zinc ion binding",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 4,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": false,
"ida_accession": "a3bfffeca780c509fc4d20700e40199a1fd7ffd5",
"counters": {
"domain_architectures": 800,
"entries": 19,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"smart": 1,
"profile": 2,
"cathgene3d": 2,
"cdd": 3,
"ssf": 2,
"pfam": 2,
"panther": 1,
"interpro": 6
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 800
}
}
}