GET /api/protein/UniProt/A0A1U7SG22/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A1U7SG22",
        "id": "A0A1U7SG22_ALLSI",
        "source_organism": {
            "taxId": "38654",
            "scientificName": "Alligator sinensis",
            "fullName": "Alligator sinensis (Chinese alligator)"
        },
        "name": "Leucine-rich repeat-containing protein 23",
        "description": [
            "Essential for sperm motility and male fertility. Plays an important role in the proper assembly of the third radial spoke (RS3) head and the bridge structure between RS2 and RS3 in the sperm flagella"
        ],
        "length": 344,
        "sequence": "MSDEEFDDESDANELEKEGEDGEEEKESAEQEEERLISNPLTEEIMKEGLSLLCKTGNGLAHAYVKLEAKEKDLTDIGLLQNYIHLRYVDLSENQLRDLSPLGSLIHLLWLKVDGNRLTSATLQELPYLQIASFAHNHIKDTEGISHPRLGSLNLKGNKIQVISGLDPGKLANLHTLELRGNKIETTAGLHLPKLKNLYLAQNSISRLEGLQDLVQLTTLHLRDNQLVTLDGFSSNMKCLQYLNLRGNGITGLQEVAKLQVLPMLRALVLLDNPCADEGDYRLEILVLLSHLERLDKDFYEQEERMEAEELRQHRQEEEQVGAAQGKNEHLGKERSWRAWGPLM",
        "proteome": "UP000189705",
        "gene": "LRRC23",
        "go_terms": [
            {
                "identifier": "GO:0005515",
                "name": "protein binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 4,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "1e4f52c0f69cdc4b04d22fcb69cc7706976d4ffc",
        "counters": {
            "domain_architectures": 23518,
            "entries": 9,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "profile": 1,
                "smart": 1,
                "pfam": 1,
                "panther": 1,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 23518
        }
    }
}