HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A1U7S7Z7",
"id": "A0A1U7S7Z7_ALLSI",
"source_organism": {
"taxId": "38654",
"scientificName": "Alligator sinensis",
"fullName": "Alligator sinensis (Chinese alligator)"
},
"name": "T-box domain-containing protein",
"description": null,
"length": 476,
"sequence": "PAPGPQAPRVDLQGAELWKRFHEIGTEMIITKAGRRMFPAMRVKISGLDPHQQYYIAMDIVPVDNKRYRYVYHSSKWMVAGNADSPVPPRVYIHPDSPASGETWMRQVISFDKLKLTNNELDDQGHIILHSMHKYQPRVHVIRKDCGDDLSPVKPIPSGEGVKAFSFPETVFTTVTAYQNQQITRLKIDRNPFAKGFRDSGRNRMGLEALVESYAFWRPSLRTLTFEDIPGIPKQGNTGSSTLLQGSGSGVPSTHPHLLPGSPCSSPAFHISPNTSQLCSLAPADYTACARSGLTLNRYSTSLAETYNRLTNQTSETFAPPRTPSYVGVSGSTTVNMSMASNDGDAFSCPQTGLSMQISGMSPQLQYIMPSPSSNAFTTNQTHQSSYNTFRLHSPCALYGYNFSTSPKLAASPEKIVSSQGSFLGSSPSGTMTDRQMLPPVEGVHLLSSGGQQNFFDSRTLGSLTLSSSQVSAHMV",
"proteome": "UP000189705",
"gene": "TBX18",
"go_terms": [
{
"identifier": "GO:0003700",
"name": "DNA-binding transcription factor activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006355",
"name": "regulation of DNA-templated transcription",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0005634",
"name": "nucleus",
"category": {
"code": "C",
"name": "cellular_component"
}
},
{
"identifier": "GO:0045893",
"name": "positive regulation of DNA-templated transcription",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0000978",
"name": "RNA polymerase II cis-regulatory region sequence-specific DNA binding",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 4,
"source_database": "unreviewed",
"is_fragment": true,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "165af3aa9983b31f89fe6a07cdc602649413625b",
"counters": {
"domain_architectures": 17687,
"entries": 15,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"cdd": 1,
"smart": 1,
"ssf": 1,
"pfam": 1,
"profile": 1,
"panther": 1,
"prosite": 2,
"prints": 1,
"interpro": 5
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 17687
}
}
}