HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A1S9ZKE5",
"id": "A0A1S9ZKE5_9GAMM",
"source_organism": {
"taxId": "90239",
"scientificName": "Moraxella canis",
"fullName": "Moraxella canis"
},
"name": "Rubredoxin",
"description": [
"Involved in the hydrocarbon hydroxylating system, which transfers electrons from NADH to rubredoxin reductase and then through rubredoxin to alkane 1 monooxygenase"
],
"length": 54,
"sequence": "MKKYQCIVCGWIYDEALGCPEEGLAPGTRWEDVPDDWLCPECGVGKEDFEMVEI",
"proteome": "UP001324384",
"gene": "U0021_09850",
"go_terms": [
{
"identifier": "GO:0005506",
"name": "iron ion binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0009055",
"name": "electron transfer activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0046872",
"name": "metal ion binding",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "6e4e309bcfe616c94578c6d62671214fe675b363",
"counters": {
"domain_architectures": 11937,
"entries": 15,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"profile": 1,
"ssf": 1,
"cathgene3d": 1,
"pfam": 1,
"cdd": 1,
"ncbifam": 1,
"panther": 1,
"pirsf": 1,
"prosite": 1,
"prints": 1,
"interpro": 5
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 11937
}
}
}