HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A1S6U5F3",
"id": "A0A1S6U5F3_9BACT",
"source_organism": {
"taxId": "1874362",
"scientificName": "Campylobacter pinnipediorum subsp. caledonicus",
"fullName": "Campylobacter pinnipediorum subsp. caledonicus"
},
"name": "Phosphoribosylglycinamide formyltransferase",
"description": [
"Catalyzes the transfer of a formyl group from 10-formyltetrahydrofolate to 5-phospho-ribosyl-glycinamide (GAR), producing 5-phospho-ribosyl-N-formylglycinamide (FGAR) and tetrahydrofolate"
],
"length": 192,
"sequence": "MLTKKIAVLFSGSGSNLQAILDKVHNKVFNSVRIEVALCISNKADAYGIQRAEKYGLETKIIENKNFSSREEFDAALVEEIKKQDIDLVVLAGFMRILTSVFTTQIKAINLHPSILPLFKGAHAIQESFDSDMQVGGVSVHWVSEELDGGKLIAQRAFERKSQMSLDDWANAIHSIEHEILPEAIVKILCNN",
"proteome": "UP000190868",
"gene": "purN",
"go_terms": [
{
"identifier": "GO:0009058",
"name": "biosynthetic process",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0004644",
"name": "phosphoribosylglycinamide formyltransferase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006189",
"name": "'de novo' IMP biosynthetic process",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "f021b3146ef7ec171dc79da7ee22bff4e1740d0f",
"counters": {
"domain_architectures": 41387,
"entries": 10,
"isoforms": 0,
"proteomes": 1,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"pfam": 1,
"ssf": 1,
"cdd": 1,
"panther": 1,
"ncbifam": 1,
"hamap": 1,
"interpro": 3
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 41387
}
}
}