General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A1S3WUB8",
        "id": "A0A1S3WUB8_ERIEU",
        "source_organism": {
            "taxId": "9365",
            "scientificName": "Erinaceus europaeus",
            "fullName": "Erinaceus europaeus (Western European hedgehog)"
        },
        "name": "Actin-associated protein FAM107A",
        "description": [
            "Stress-inducible actin-binding protein that plays a role in synaptic and cognitive functions by modulating actin filamentous (F-actin) dynamics. Mediates polymerization of globular actin to F-actin. Also binds to, stabilizes and bundles F-actin. Involved in synaptic function by regulating neurite outgrowth in an actin-dependent manner and for the acquisition of hippocampus-dependent cognitive function, such as learning and long-term memory. Plays a role in the actin and microtubule cytoskeleton organization; negatively regulates focal adhesion (FA) assembly promoting malignant glial cell migration in an actin-, microtubule- and MAP1A-dependent manner. Also involved in neuroblastoma G1/S phase cell cycle progression and cell proliferation inhibition by stimulating ubiquitination of NF-kappa-B subunit RELA and NF-kappa-B degradation in a COMMD1- and actin-dependent manner. May play a role in tumor development"
        ],
        "length": 144,
        "sequence": "MYSEIQRERSDIGGLMACPEHREWNPELIKPKKLLNPVKASRSHQELHRELLMNHRRGIGVDNKPELQRVLEHRRRNQLIKKKKEEMEAKRLQCPFEQELLRRQQRLNQLEKPVEKEEDHAPEFIRVRENLRRIATLTSEERVL",
        "proteome": "UP001652624",
        "gene": "FAM107A",
        "go_terms": null,
        "protein_evidence": 4,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "64aead8d9a6000fb7d9a119655ab48f78e79c7e4",
        "counters": {
            "domain_architectures": 3492,
            "entries": 3,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "panther": 1,
                "pfam": 1,
                "interpro": 1
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 3492
        }
    }
}