General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A1S3WSS1",
        "id": "A0A1S3WSS1_ERIEU",
        "source_organism": {
            "taxId": "9365",
            "scientificName": "Erinaceus europaeus",
            "fullName": "Erinaceus europaeus (Western European hedgehog)"
        },
        "name": "Phosphatidylinositol N-acetylglucosaminyltransferase subunit P",
        "description": [
            "Part of the complex catalyzing the transfer of N-acetylglucosamine from UDP-N-acetylglucosamine to phosphatidylinositol, the first step of GPI biosynthesis"
        ],
        "length": 134,
        "sequence": "MVENSPSPLPERAIYGFVLFLSSQFGFILYLVWAFVPESWLHSLGLTYWPQKYWAVALPVYLLITVAIGYVLLFGVNMANTSPLDSLHTITDSYAKKQQQKKHQKEAIPALRDVPINEVNKMFFFPAKAQHTQH",
        "proteome": "UP001652624",
        "gene": "PIGP",
        "go_terms": [
            {
                "identifier": "GO:0017176",
                "name": "phosphatidylinositol N-acetylglucosaminyltransferase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006506",
                "name": "GPI anchor biosynthetic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "63d625aebca36dff5d9df899680f5b452f6f2c81",
        "counters": {
            "domain_architectures": 3920,
            "entries": 6,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "pirsf": 1,
                "panther": 1,
                "pfam": 1,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 3920
        }
    }
}