General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A1S3WLA0",
        "id": "A0A1S3WLA0_ERIEU",
        "source_organism": {
            "taxId": "9365",
            "scientificName": "Erinaceus europaeus",
            "fullName": "Erinaceus europaeus (Western European hedgehog)"
        },
        "name": "Granulocyte colony-stimulating factor",
        "description": [
            "Granulocyte/macrophage colony-stimulating factors are cytokines that act in hematopoiesis by controlling the production, differentiation, and function of 2 related white cell populations of the blood, the granulocytes and the monocytes-macrophages. This CSF induces granulocytes"
        ],
        "length": 224,
        "sequence": "MYKSSLELVTNRVPSLLPRPSAEPAARSPMKLIALQLLLWHSTLWILQTTAPLALALDLPQNFLLKCLEQVRKIQADSTALQEKLCATHRLCHPEELVLLGHSLGIPQARLSRCSSQTLQLMGCLDQLHRGLFLYQGLLQALAGVSPELAPTVDLLHLDIADFATNIWQQMEDLGVDPAVKPTQGTMPTFTSAFQRRAGGVLVASNLQSFLEGAYRALHYLAEA",
        "proteome": "UP001652624",
        "gene": "CSF3",
        "go_terms": [
            {
                "identifier": "GO:0005125",
                "name": "cytokine activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0045639",
                "name": "positive regulation of myeloid cell differentiation",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0006955",
                "name": "immune response",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0005576",
                "name": "extracellular region",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "dd6031ddee8b22da3a3ddf9ce1e1c615dd71d4a5",
        "counters": {
            "domain_architectures": 670,
            "entries": 11,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "pfam": 1,
                "smart": 1,
                "panther": 1,
                "prosite": 1,
                "prints": 1,
                "interpro": 4
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 670
        }
    }
}