GET /api/protein/UniProt/A0A1S3FQA9/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A1S3FQA9",
        "id": "A0A1S3FQA9_DIPOR",
        "source_organism": {
            "taxId": "10020",
            "scientificName": "Dipodomys ordii",
            "fullName": "Dipodomys ordii (Ord's kangaroo rat)"
        },
        "name": "NFU1 iron-sulfur cluster scaffold homolog, mitochondrial",
        "description": [
            "Iron-sulfur cluster scaffold protein which can assemble [4Fe-4S] clusters and deliver them to target proteins"
        ],
        "length": 229,
        "sequence": "MMNPYVIKKQSLHQFVRRSPFPPHPALHHAVRHMFIQTQDTPNPNSLKFIPGKPVLETRTMDFPSPAAAFCSPLARQLFRIEGVKSVFFGPDFITVTKENEEIDWNLLKPDIYATIMDFFASGLPLVTEETPAGEAGSEEDDEVVAMIKELLDTRIRPTVQEDGGDVIYKGFEDGIVQLKLQGSCTSCPSSIITLKNGIQNMLQFYIPEVEGVEQVMDDESDEKEANSS",
        "proteome": "UP000081671",
        "gene": "Nfu1",
        "go_terms": [
            {
                "identifier": "GO:0005506",
                "name": "iron ion binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0051536",
                "name": "iron-sulfur cluster binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0016226",
                "name": "iron-sulfur cluster assembly",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "e1fd1d9683372ef6d9e78b5b1563df7002e9fbe9",
        "counters": {
            "domain_architectures": 8594,
            "entries": 14,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 2,
                "ssf": 2,
                "smart": 1,
                "pfam": 2,
                "pirsf": 1,
                "panther": 1,
                "interpro": 5
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 8594
        }
    }
}