HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A1S3ACZ2",
"id": "A0A1S3ACZ2_ERIEU",
"source_organism": {
"taxId": "9365",
"scientificName": "Erinaceus europaeus",
"fullName": "Erinaceus europaeus (Western European hedgehog)"
},
"name": "Tumor necrosis factor receptor superfamily member 5",
"description": [
"Receptor for TNFSF5/CD40LG. Transduces TRAF6- and MAP3K8-mediated signals that activate ERK in macrophages and B cells, leading to induction of immunoglobulin secretion"
],
"length": 269,
"sequence": "MVRLPLQCLVWGCLLTAVYPESSTTCRENKYYKNGQCCDLCPPGKKLVKDCIENSQTECISCNDDEFLPSWNAETRCHQHKYCDHNLGLRVQKKGTLKSDTICMCDEGQHCTSEACERCILHSLCSPGYGVKQIATGISDTKCEPCPFGFFSNVSSSSEKCRPWTSCETKGLEEQQPGTNMTDAVCGFRPRMRALVVIPITIGLLFAVVLLSFCIRKVASNKEPVVEVLPMKHPVETEDLPPVQETLHGYQPVTQEDGKESRISVQERL",
"proteome": "UP001652624",
"gene": "CD40",
"go_terms": [
{
"identifier": "GO:0005515",
"name": "protein binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0038023",
"name": "signaling receptor activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0042113",
"name": "B cell activation",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0050776",
"name": "regulation of immune response",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0009897",
"name": "external side of plasma membrane",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 4,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "5bbf0225a514fc2e3ae934acfbb064eee472febd",
"counters": {
"domain_architectures": 4823,
"entries": 13,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"profile": 1,
"smart": 1,
"ssf": 1,
"cdd": 1,
"pfam": 1,
"panther": 1,
"prosite": 1,
"prints": 1,
"interpro": 4
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 4823
}
}
}