GET /api/protein/UniProt/A0A1S3ACZ2/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A1S3ACZ2",
        "id": "A0A1S3ACZ2_ERIEU",
        "source_organism": {
            "taxId": "9365",
            "scientificName": "Erinaceus europaeus",
            "fullName": "Erinaceus europaeus (Western European hedgehog)"
        },
        "name": "Tumor necrosis factor receptor superfamily member 5",
        "description": [
            "Receptor for TNFSF5/CD40LG. Transduces TRAF6- and MAP3K8-mediated signals that activate ERK in macrophages and B cells, leading to induction of immunoglobulin secretion"
        ],
        "length": 269,
        "sequence": "MVRLPLQCLVWGCLLTAVYPESSTTCRENKYYKNGQCCDLCPPGKKLVKDCIENSQTECISCNDDEFLPSWNAETRCHQHKYCDHNLGLRVQKKGTLKSDTICMCDEGQHCTSEACERCILHSLCSPGYGVKQIATGISDTKCEPCPFGFFSNVSSSSEKCRPWTSCETKGLEEQQPGTNMTDAVCGFRPRMRALVVIPITIGLLFAVVLLSFCIRKVASNKEPVVEVLPMKHPVETEDLPPVQETLHGYQPVTQEDGKESRISVQERL",
        "proteome": "UP001652624",
        "gene": "CD40",
        "go_terms": [
            {
                "identifier": "GO:0005515",
                "name": "protein binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0038023",
                "name": "signaling receptor activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0042113",
                "name": "B cell activation",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0050776",
                "name": "regulation of immune response",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0009897",
                "name": "external side of plasma membrane",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 4,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "5bbf0225a514fc2e3ae934acfbb064eee472febd",
        "counters": {
            "domain_architectures": 4823,
            "entries": 13,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "profile": 1,
                "smart": 1,
                "ssf": 1,
                "cdd": 1,
                "pfam": 1,
                "panther": 1,
                "prosite": 1,
                "prints": 1,
                "interpro": 4
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 4823
        }
    }
}