General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A1S1AE30",
        "id": "A0A1S1AE30_SALER",
        "source_organism": {
            "taxId": "28901",
            "scientificName": "Salmonella enterica",
            "fullName": "Salmonella enterica"
        },
        "name": "Hydrogenase maturation factor HypA",
        "description": [
            "Involved in the maturation of [NiFe] hydrogenases. Required for nickel insertion into the metal center of the hydrogenase"
        ],
        "length": 113,
        "sequence": "MHELALAQNIIELLEEQAVNHQFSKVKQVWLEIGVMACVEVPALHFGLDVAARHTLADNASFHITIAPAQGWCLSCNQPFTSQTSTLCCPFCHSGKVQIDDSSRMRIREIEVE",
        "proteome": null,
        "gene": "hypA",
        "go_terms": [
            {
                "identifier": "GO:0016151",
                "name": "nickel cation binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0051604",
                "name": "protein maturation",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "eb30097e2f8e3b1d58ac74db9274597641c5af5a",
        "counters": {
            "domain_architectures": 8364,
            "entries": 7,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "pfam": 1,
                "cathgene3d": 1,
                "pirsf": 1,
                "panther": 1,
                "ncbifam": 1,
                "hamap": 1,
                "interpro": 1
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 8364
        }
    }
}