GET /api/protein/UniProt/A0A1R4EPS2/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A1R4EPS2",
        "id": "A0A1R4EPS2_9MICC",
        "source_organism": {
            "taxId": "71253",
            "scientificName": "Arthrobacter rhombi",
            "fullName": "Arthrobacter rhombi"
        },
        "name": "Tryptophan 2,3-dioxygenase",
        "description": [
            "Heme-dependent dioxygenase that catalyzes the oxidative cleavage of the L-tryptophan (L-Trp) pyrrole ring and converts L-tryptophan to N-formyl-L-kynurenine. Catalyzes the oxidative cleavage of the indole moiety"
        ],
        "length": 296,
        "sequence": "MSCPYSQDTPETPGTDTGERDIEETVRTDFRNEMSYGGYLDLDKVLHAQHPHSNPEHHDELLFIIQHQTSELWLKLVLHELVEARRLMDADDLGKALKCLARVKHIQKVLTDQWSVLATLTPREYAQFRDTLGSASGFQSWQYRAVEFILGNKHRGMLKVFESHPEAHAMLSQLLEEPTVYDAFLAALSRAGYPISEEILHRDFSKAWVLHEELIPVFKEIYETEETRWGFYQACEDLVDLEDNFQAWRFRHLRTVQRTIGFKRGTGGSSGVDFLRRALDLTFFPELYAVRTEIGN",
        "proteome": "UP000195913",
        "gene": "kynA",
        "go_terms": [
            {
                "identifier": "GO:0020037",
                "name": "heme binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0046872",
                "name": "metal ion binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0019441",
                "name": "L-tryptophan catabolic process to L-kynurenine",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0004833",
                "name": "L-tryptophan 2,3-dioxygenase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "aff128451d43e340f1379ffdcbc3092f5b264d66",
        "counters": {
            "domain_architectures": 4439,
            "entries": 9,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "panther": 1,
                "pfam": 1,
                "hamap": 1,
                "ncbifam": 1,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 4439
        }
    }
}