GET /api/protein/UniProt/A0A1R3M158/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A1R3M158",
"id": "A0A1R3M158_MAIZE",
"source_organism": {
"taxId": "4577",
"scientificName": "Zea mays",
"fullName": "Zea mays (Maize)"
},
"name": "2,4-dihydroxy-7-methoxy-2H-1,4-benzoxazin-3(4H)-one 2-D-glucosyltransferase",
"description": [
"Glucosyltransferase involved in the last step of benzoxazinoid glucoside biosynthesis. Catalyzes the glucosylation of hydroxamic acids utilizing UDP-glucose as glucose doner, reducing the toxicity of these natural insecticides for storage. Can use DIMBOA and DIBOA as substrates, HMBOA (2-hydroxy-7-methoxy-2H-1,4-benzoxazin-3(4H)-one) and HBOA (2-hydroxy-2H-1,4-benzoxazin-3(4H)-one) with a lower efficiency, but not indole acetic acid or quercitin"
],
"length": 462,
"sequence": "MASSRTGAGAGGRVVVFPFPFQGHFNPVMRLARALHARGLAITVFHSGALDPADYPADYRFVPVTVEADPKLLASEDIAAIVTTLNASCDAPFRARLSALLAAEGRDSVRCVFTDVSWNAVLTASSDLGVPALGMMTASAASLRDYMAYRTLIDKGYLPVKEERKEDPVPELPPYLVKDLLRVDTSDLEEFAELLARTVTAARRASGLIFNTFPLIETDTLAEIHKALSVPVFAVAPLNKLVPTATASLHGVVQADRGCLQWLDTQQPGSVLYVSFGSMAAMDPHEFVELAWGLADSKRPFVWVVRPNLIRGFESGALPDGVEDEVRGRGIVVAWAPQEEVLAHPAVGGFLTHNGWNSTVEAISEGVPMVCCPRHGDQFGNMRYVCDVWKVGTELVGEQLERGQVKAAIDRLFGTKEGEEIKERMKEFKIAAAKGIGIGVDVDETASPRTDLTDLVDLIKSF",
"proteome": null,
"gene": "ZEAMMB73_Zm00001d031209",
"go_terms": [
{
"identifier": "GO:0008194",
"name": "UDP-glycosyltransferase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "781f331c11f55b381926aa2b09b4b07d5b4d0620",
"counters": {
"domain_architectures": 97521,
"entries": 6,
"isoforms": 0,
"proteomes": 0,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cdd": 1,
"ssf": 1,
"cathgene3d": 1,
"panther": 1,
"pfam": 1,
"interpro": 1
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 97521
}
}
}