HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A1R2LZI9",
"id": "A0A1R2LZI9_SALEN",
"source_organism": {
"taxId": "149539",
"scientificName": "Salmonella enteritidis",
"fullName": "Salmonella enteritidis"
},
"name": "Ribosome-binding ATPase YchF",
"description": [
"ATPase that binds to both the 70S ribosome and the 50S ribosomal subunit in a nucleotide-independent manner. Does not hydrolyze GTP"
],
"length": 363,
"sequence": "MGFKCGIVGLPNVGKSTLFNALTKAGIEAANFPFCTIEPNTGVVPMPDPRLDQLAEIVKPQRILPTTMEFVDIAGLVKGASKGEGLGNQFLTNIRETEAIGHVVRCFENDNIIHVAGKVNPAEDIDVINTELALADLDTCERAIHRVQKKAKGGDKDAKAELAALEKCLPHLAEAGMLRSLDLTDEDKAAIRYLSFLTLKPTMYIANVNEDGFENNPYLDQVREIAAKEGSVVVPVCAAVEADIAELDDDERDEFMAELGLEEPGLNRVIRAGYRLLNLQTYFTAGVKEVRAWTIPVGATAPQAAGKIHTDFEKGFIRAQTIAFDDFITYKGEQGAKEAGKMRAEGKDYIVKDGDIMNFLFNV",
"proteome": null,
"gene": "ychF",
"go_terms": [
{
"identifier": "GO:0005525",
"name": "GTP binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0005524",
"name": "ATP binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0016887",
"name": "ATP hydrolysis activity",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "066ef894bb32b87add2d6c34545d4b0b029462a5",
"counters": {
"domain_architectures": 30322,
"entries": 26,
"isoforms": 0,
"proteomes": 0,
"sets": 4,
"structures": 0,
"taxa": 1,
"dbEntries": {
"profile": 2,
"ssf": 2,
"cathgene3d": 3,
"cdd": 2,
"pfam": 2,
"ncbifam": 1,
"hamap": 1,
"pirsf": 1,
"panther": 1,
"prints": 1,
"interpro": 10
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 30322
}
}
}