General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A1Q5Q918",
        "id": "A0A1Q5Q918_TALAT",
        "source_organism": {
            "taxId": "1441469",
            "scientificName": "Talaromyces atroroseus",
            "fullName": "Talaromyces atroroseus"
        },
        "name": "Branchpoint-bridging protein",
        "description": [
            "Necessary for the splicing of pre-mRNA. Has a role in the recognition of the branch site (5'-UACUAAC-3'), the pyrimidine tract and the 3'-splice site at the 3'-end of introns"
        ],
        "length": 560,
        "sequence": "MSWRNQQGITGSNNIPLGKRRFGGDDEGASEASTPTPAASDNGALRGRSPTRADQPADGVKRRKKRNRWGDAQENKAAGLMGLPTMIMANFTNEQLEAYTLHLRIEEISQKLRINDVVPADGDRSPSPPPQYDNFGRRVNTREYRYRKRLEDERHKLVERAMKVIPNYHPPSDYRRPTKTQEKVYVPVNDYPEINFIGLLIGPRGNTLKTMEKESGAKIAIRGKGSVKEGKGRSDAAHTSNQEEDLHCLIMADTEEKVNKAKQLVHNVIETAASIPEGQNELKRNQLRELAALNGTLRDDENQACQNCGQIGHRKYDCPEQRNFTANIICRVCGNAGHMARDCPDRQRGTDWRNNGGYGGRGPHRAIGGGDAVDREMEQLMQELSGGGSGPNGEAPRRIEGAPGGYEQQDSNYKPWQQRGPPASDVAPWQQRGREHRGRDDYESRDTNDAAPWAQSRGGGNYGYGSHHGNYSAPGAASGAAPWQQQAPPPPPGGQAGYGYGYSAFPPPPPSGAPPGLPGAPPGMESMYYGGAGAPPPPPPGEGPPPPPPSDQPPPPPPPA",
        "proteome": "UP000214365",
        "gene": "UA08_04086",
        "go_terms": [
            {
                "identifier": "GO:0003723",
                "name": "RNA binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0003676",
                "name": "nucleic acid binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0008270",
                "name": "zinc ion binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "86f09853b57201d09021aa7620496b62984e1370",
        "counters": {
            "domain_architectures": 1169,
            "entries": 22,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 3,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "pfam": 3,
                "cathgene3d": 3,
                "smart": 2,
                "cdd": 1,
                "ssf": 2,
                "profile": 2,
                "panther": 1,
                "interpro": 8
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 1169
        }
    }
}