GET /api/protein/UniProt/A0A1P8DB83/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A1P8DB83",
        "id": "A0A1P8DB83_9APIA",
        "source_organism": {
            "taxId": "44681",
            "scientificName": "Panax pseudoginseng",
            "fullName": "Panax pseudoginseng"
        },
        "name": "DNA-directed RNA polymerase",
        "description": [
            "DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates"
        ],
        "length": 144,
        "sequence": "ETLLGKRVDYSGRSVIVVGPSLSLHRCGLPREIAIELFQTFVIRGLIRQHLASNIGVAKSKIREKEPIVWEILQEVMQGHPVLLNRAPTLHRLGIQAFQPVLVEGRAICLHPLVRKGFNADFDGDQMAVHVPLSLEAQAEARLL",
        "proteome": null,
        "gene": "rpoC1",
        "go_terms": [
            {
                "identifier": "GO:0003677",
                "name": "DNA binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0003899",
                "name": "DNA-directed RNA polymerase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006351",
                "name": "DNA-templated transcription",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": true,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "3376c04b65c803996aca8342236c6155f0bd333f",
        "counters": {
            "domain_architectures": 5696,
            "entries": 9,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "smart": 1,
                "cathgene3d": 2,
                "ssf": 1,
                "pfam": 1,
                "panther": 1,
                "interpro": 3
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 5696
        }
    }
}