General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A1M4UXK0",
        "id": "A0A1M4UXK0_9SPHI",
        "source_organism": {
            "taxId": "288992",
            "scientificName": "Pedobacter caeni",
            "fullName": "Pedobacter caeni"
        },
        "name": "Release factor glutamine methyltransferase",
        "description": [
            "Methylates the class 1 translation termination release factors RF1/PrfA and RF2/PrfB on the glutamine residue of the universally conserved GGQ motif"
        ],
        "length": 278,
        "sequence": "MNLSQLLQHFKTELKDVYEEEEVKSIFSIVTEHLIQFNRSKLMLNWDKEPEPAQEASFLAIATGLKTHQPIQYLLGEAFFYGSTFKVNESVLIPRPETEELVDWILEKKVEGQTVIDFGTGSGCIAISLKKHLKDASVTAVDISEDAIRTASENASLNHADVCFIHADILTFQSKEKFDIIVSNPPYITGAEMAEMQQNVLAHEPHLALFVSDERPLLFYEAIADFALSNLQPEGTLFFEINEYLSKETISMLKDKSFKIIELRKDMQGKDRMISAKL",
        "proteome": "UP000184287",
        "gene": "prmC",
        "go_terms": [
            {
                "identifier": "GO:0008168",
                "name": "methyltransferase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0008276",
                "name": "protein methyltransferase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006479",
                "name": "protein methylation",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0003676",
                "name": "nucleic acid binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0032259",
                "name": "methylation",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "d4221e86f6937d5af712787f4edf6ea8c5333535",
        "counters": {
            "domain_architectures": 20683,
            "entries": 18,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 2,
                "pfam": 2,
                "ssf": 1,
                "cdd": 1,
                "ncbifam": 2,
                "hamap": 1,
                "panther": 1,
                "prosite": 1,
                "interpro": 7
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 20683
        }
    }
}