GET /api/protein/UniProt/A0A1L9WTX1/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A1L9WTX1",
"id": "A0A1L9WTX1_ASPA1",
"source_organism": {
"taxId": "690307",
"scientificName": "Aspergillus aculeatus (strain ATCC 16872 / CBS 172.66 / WB 5094)",
"fullName": "Aspergillus aculeatus (strain ATCC 16872 / CBS 172.66 / WB 5094)"
},
"name": "Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit WBP1",
"description": [
"Subunit of the oligosaccharyl transferase (OST) complex that catalyzes the initial transfer of a defined glycan (Glc(3)Man(9)GlcNAc(2) in eukaryotes) from the lipid carrier dolichol-pyrophosphate to an asparagine residue within an Asn-X-Ser/Thr consensus motif in nascent polypeptide chains, the first step in protein N-glycosylation. N-glycosylation occurs cotranslationally and the complex associates with the Sec61 complex at the channel-forming translocon complex that mediates protein translocation across the endoplasmic reticulum (ER)"
],
"length": 458,
"sequence": "MRWCLSFFLFGFLAVVNALSSSGNRLLVVLEDASEKGLYSTLWSDLKARGYDIAFESPKSDQLSLFELGDRAYDHLLLLPPKSKGFGPSLSPKNIVDFLNKDGNVLLALSGKSTTPSAISSLLLELDLHLSTDRSSIVVDHFNYDTLSAAEKHDVLLLQRPGQLRPDTKSYFDGEGVLALPRAAPHTLGDNILAAPILRAPVTAYSYNPKEETAAVEDIWATGSQLSLISTLQTRSSSRFTLLGSVESLQDKWFTATVKAPGSGEETKTVNQEFAKQLTAWTFKETGVLKVGKIEHHLAQDDITAEDLNPTIYRVKNETVFSIEISEYSYDKFVPFELPAEDALQLEFTMLSPFHRLKLEPAYRTENSTVFRTQFTVPDQHGIFSFRVNYKRPFLTTIEEKHEVTVRHFAHNEFPRSWEISGGWVWIAGLWSVIGGFMAFVAVWLYSEPTSAQVKKNQ",
"proteome": "UP000184546",
"gene": "ASPACDRAFT_119293",
"go_terms": [
{
"identifier": "GO:0006487",
"name": "protein N-linked glycosylation",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0005789",
"name": "endoplasmic reticulum membrane",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "4d21a3a090e01091f1107c3587b47176f7b21591",
"counters": {
"domain_architectures": 4436,
"entries": 6,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"pfam": 2,
"panther": 1,
"interpro": 3
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 4436
}
}
}