HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A1L9UTZ1",
"id": "A0A1L9UTZ1_ASPBC",
"source_organism": {
"taxId": "767769",
"scientificName": "Aspergillus brasiliensis (strain CBS 101740 / IMI 381727 / IBT 21946)",
"fullName": "Aspergillus brasiliensis (strain CBS 101740 / IMI 381727 / IBT 21946)"
},
"name": "DNA sliding clamp PCNA",
"description": [
"This protein is an auxiliary protein of DNA polymerase delta and is involved in the control of eukaryotic DNA replication by increasing the polymerase's processibility during elongation of the leading strand. Involved in DNA repair",
"This protein is an auxiliary protein of DNA polymerase delta and is involved in the control of eukaryotic DNA replication by increasing the polymerase's processivity during elongation of the leading strand"
],
"length": 258,
"sequence": "MLEARLEQASLLKRVVDAIKDLVQDCNFDCNDSGISLQAMDNSHVALVSMMLKAEGFSPYRCDRNIALGINLLSLTKVLRAAQNEDILTLKAEDSPDAVNLMFESAETDRLSEYDIKLMDIDQEHLAIPETEYAATVEMPAAEFQRICRDLNALSESVVIEATKEGVKFSCQGDIGSGSVTVRQHTNVENPAQNVSISLTEPVALTFSLKYLVNFCKATNLSNKVTLCLSQEVPLLVEYGLGSGHLRFYLAPKIGDEE",
"proteome": "UP000184499",
"gene": "ASPBRDRAFT_473652",
"go_terms": [
{
"identifier": "GO:0003677",
"name": "DNA binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006275",
"name": "regulation of DNA replication",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0030337",
"name": "DNA polymerase processivity factor activity",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "a97d7b10b1c940cf6f311b1cde9d20a761bdaed3",
"counters": {
"domain_architectures": 5872,
"entries": 16,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"pfam": 2,
"ssf": 1,
"cathgene3d": 1,
"cdd": 1,
"panther": 1,
"ncbifam": 1,
"hamap": 1,
"prints": 1,
"prosite": 2,
"interpro": 5
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 5872
}
}
}