GET /api/protein/UniProt/A0A1L8DAY9/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A1L8DAY9",
        "id": "A0A1L8DAY9_9DIPT",
        "source_organism": {
            "taxId": "330878",
            "scientificName": "Nyssomyia neivai",
            "fullName": "Nyssomyia neivai"
        },
        "name": "Prostaglandin reductase 1",
        "description": null,
        "length": 358,
        "sequence": "MTWLFRPLFTVRAYVRNFSTKLEMQSRVFKFAKRYEGVPKTTDFDLKIEDVKALEENEILCEGKYWSVDPYMRVYMDSHPVGVTMIGGQVAKVIETKHPKFPVNSWIFAYFGWRTHTVVNPDKVPEDAQFRSLPELGTLSPSLALGNLGMPGNTAYFGLMELCQPKSGETVVVSGAAGAVGSAVGQIAKIKGCRVVGIAGGTQKCSWLRKEMGFDATIDYKTENVRKALKECAPKGVDCYFDNVGGEISSAVISNMNLFGRIAVCGAISSYNDDVKSWPKVPHVQPEFVFKQLKMEGFIVTRWLHRWMEGILQIKEWMKEGKIKNPETFTEGFENLPRAFIEMLEGKNVGKAIVRAKM",
        "proteome": null,
        "gene": null,
        "go_terms": [
            {
                "identifier": "GO:0032440",
                "name": "2-alkenal reductase [NAD(P)H] activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0047522",
                "name": "15-oxoprostaglandin 13-reductase [NAD(P)+] activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0005737",
                "name": "cytoplasm",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            },
            {
                "identifier": "GO:0016491",
                "name": "oxidoreductase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0016628",
                "name": "oxidoreductase activity, acting on the CH-CH group of donors, NAD or NADP as acceptor",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "5868aa2108b93d49c5c92d05158401122f1a86a6",
        "counters": {
            "domain_architectures": 28175,
            "entries": 16,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 3,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cdd": 1,
                "ssf": 2,
                "cathgene3d": 2,
                "smart": 1,
                "pfam": 2,
                "panther": 1,
                "interpro": 7
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 28175
        }
    }
}