General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A1L5BNS4",
        "id": "A0A1L5BNS4_SPHIB",
        "source_organism": {
            "taxId": "861109",
            "scientificName": "Sphingobium indicum (strain DSM 16412 / CCM 7286 / MTCC 6364 / B90A)",
            "fullName": "Sphingobium indicum (strain DSM 16412 / CCM 7286 / MTCC 6364 / B90A)"
        },
        "name": "Cytochrome bo(3) ubiquinol oxidase subunit 3",
        "description": [
            "Cytochrome bo(3) ubiquinol terminal oxidase is the component of the aerobic respiratory chain of E.coli that predominates when cells are grown at high aeration. Has proton pump activity across the membrane in addition to electron transfer, pumping 2 protons/electron"
        ],
        "length": 227,
        "sequence": "MAQGIRDREVIAPTLREIAADWSADQEVFRQTHWGKAMMWIFLLSDTFIFSCFLTGYMTVRASAVLPWPNTAEVFALSIGGQDIPLILIAIMTFVLISSSGTMAMAVNFGYRRDRRKTAALMLLTALFGATFVSMQAFEWTKLIEEGVRPWSNPMGAPQFGASFFMITGFHGLHVTCGVILLLIIAYKVARGHYDRTGDYSAVEIAGLYWHFVDLVWVFIFAFFYLW",
        "proteome": null,
        "gene": "SIDU_08550",
        "go_terms": [
            {
                "identifier": "GO:0004129",
                "name": "cytochrome-c oxidase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0016020",
                "name": "membrane",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            },
            {
                "identifier": "GO:0009055",
                "name": "electron transfer activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0022904",
                "name": "respiratory electron transport chain",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0019646",
                "name": "aerobic electron transport chain",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "663ba42a1d577dd726fd8458ee1fa2f51292c5b5",
        "counters": {
            "domain_architectures": 68158,
            "entries": 10,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "profile": 1,
                "ssf": 1,
                "cdd": 1,
                "cathgene3d": 1,
                "pfam": 1,
                "panther": 1,
                "interpro": 4
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 68158
        }
    }
}