HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A1L3MY48",
"id": "A0A1L3MY48_ARRXA",
"source_organism": {
"taxId": "264540",
"scientificName": "Arracacia xanthorrhiza",
"fullName": "Arracacia xanthorrhiza (Arracacha)"
},
"name": "ATP synthase epsilon chain, chloroplastic",
"description": [
"Produces ATP from ADP in the presence of a proton gradient across the membrane"
],
"length": 140,
"sequence": "MTLNLCVLTPNRTVWNSKVNEIILSTNSGQIGVLPNHASVATAVDIGILKIRLDGQWLTMALMGGFARIGNNEITVLVNDAEKGSDIDSQEARQTLEIAEANLRKAEGKRQKIEANLALRRARTRVETINEISELVGVSE",
"proteome": null,
"gene": "atpE",
"go_terms": [
{
"identifier": "GO:0015986",
"name": "proton motive force-driven ATP synthesis",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0046933",
"name": "proton-transporting ATP synthase activity, rotational mechanism",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0045259",
"name": "proton-transporting ATP synthase complex",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "6376a3906ef3eefc3872d0227b1dc6d17ed462fe",
"counters": {
"domain_architectures": 24339,
"entries": 13,
"isoforms": 0,
"proteomes": 0,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 1,
"cathgene3d": 2,
"pfam": 2,
"cdd": 1,
"hamap": 1,
"ncbifam": 1,
"panther": 1,
"interpro": 4
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 24339
}
}
}