General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A1L3GQX3",
        "id": "A0A1L3GQX3_9BACT",
        "source_organism": {
            "taxId": "1842532",
            "scientificName": "Syntrophotalea acetylenivorans",
            "fullName": "Syntrophotalea acetylenivorans"
        },
        "name": "Glutaredoxin",
        "description": [
            "Has a glutathione-disulfide oxidoreductase activity in the presence of NADPH and glutathione reductase. Reduces low molecular weight disulfides and proteins"
        ],
        "length": 84,
        "sequence": "MKRVEIYTKDHCPYCHRAKDLLESKNVPFVEYDVSTDSVKEQEMRQRSGRMTVPEIFIDDTLIGGCDDLFALETSGNLDDHLGI",
        "proteome": "UP000182517",
        "gene": "A7E78_10910",
        "go_terms": [
            {
                "identifier": "GO:0045454",
                "name": "cell redox homeostasis",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "d2844775b51693340b21c3e9e12379eeddc0df70",
        "counters": {
            "domain_architectures": 69322,
            "entries": 14,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "profile": 1,
                "pfam": 1,
                "cdd": 1,
                "panther": 1,
                "ncbifam": 1,
                "prints": 1,
                "prosite": 1,
                "interpro": 5
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 69322
        }
    }
}