GET /api/protein/UniProt/A0A1I6YAW5/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A1I6YAW5",
"id": "A0A1I6YAW5_9BURK",
"source_organism": {
"taxId": "1324617",
"scientificName": "Paraburkholderia aspalathi",
"fullName": "Paraburkholderia aspalathi"
},
"name": "Nucleoid-associated protein R69658_03778",
"description": [
"Binds to DNA and alters its conformation. May be involved in regulation of gene expression, nucleoid organization and DNA protection"
],
"length": 108,
"sequence": "MMKGQLAGLMKQAQQMQENMKKMQEQLALIEVEGQSGAGLVKVTMTCKNDVRRVSIDPSLLADDKDMLEDLVAAAFNDAVRKAEATAQEKMGGMTSGLPLPPGFKLPF",
"proteome": "UP000674425",
"gene": "ybaB",
"go_terms": [
{
"identifier": "GO:0003677",
"name": "DNA binding",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "a1d105df1f44a0ec24fb5f7ecfa8115df2d4b842",
"counters": {
"domain_architectures": 30139,
"entries": 9,
"isoforms": 0,
"proteomes": 1,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"ncbifam": 1,
"hamap": 1,
"pirsf": 1,
"panther": 1,
"pfam": 1,
"interpro": 2
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 30139
}
}
}