General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A1I3QY42",
        "id": "A0A1I3QY42_9EURY",
        "source_organism": {
            "taxId": "44930",
            "scientificName": "Natronobacterium gregoryi",
            "fullName": "Natronobacterium gregoryi"
        },
        "name": "Signal recognition particle 19 kDa protein",
        "description": [
            "Involved in targeting and insertion of nascent membrane proteins into the cytoplasmic membrane. Binds directly to 7S RNA and mediates binding of the 54 kDa subunit of the SRP"
        ],
        "length": 93,
        "sequence": "MVENVIWPAYLDASLSRSEGRRVSSDLAVEEPTVDEIAKAVQQIGYDATIERDKSYSREHWAQRGRVVVRGADDSTKNDLVQAVAAYVVAMRE",
        "proteome": null,
        "gene": "srp19",
        "go_terms": [
            {
                "identifier": "GO:0008312",
                "name": "7S RNA binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006614",
                "name": "SRP-dependent cotranslational protein targeting to membrane",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0048500",
                "name": "signal recognition particle",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "22a9a2a55780b728fc62994b341e9e326c359d47",
        "counters": {
            "domain_architectures": 5329,
            "entries": 10,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "ncbifam": 1,
                "panther": 1,
                "pfam": 1,
                "hamap": 1,
                "interpro": 4
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 5329
        }
    }
}