GET /api/protein/UniProt/A0A1H8YS28/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A1H8YS28",
        "id": "A0A1H8YS28_9BACI",
        "source_organism": {
            "taxId": "571933",
            "scientificName": "Piscibacillus halophilus",
            "fullName": "Piscibacillus halophilus"
        },
        "name": "Phosphopantetheine adenylyltransferase",
        "description": [
            "Reversibly transfers an adenylyl group from ATP to 4'-phosphopantetheine, yielding dephospho-CoA (dPCoA) and pyrophosphate"
        ],
        "length": 159,
        "sequence": "MPKTAICPGSFDPITYGHLDIIRRGAKIFDHVIVAVFNNRSKSPLFSVEERLELIREATKDLPNVSCDVSQGLLVDYAQKKNVDVILRGLRAVSDFEYEMQITSMNRKLDENIETFFMMTNNQYSFLSSSIVKEAAKYQSDVSDLVPEVVANALKEKYK",
        "proteome": "UP000199427",
        "gene": "coaD",
        "go_terms": [
            {
                "identifier": "GO:0004595",
                "name": "pantetheine-phosphate adenylyltransferase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0015937",
                "name": "coenzyme A biosynthetic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0003824",
                "name": "catalytic activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0009058",
                "name": "biosynthetic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "67074276eca3dd0a1392f72a13e344b6dc27e68b",
        "counters": {
            "domain_architectures": 82434,
            "entries": 12,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "cdd": 1,
                "ncbifam": 2,
                "pfam": 1,
                "panther": 1,
                "hamap": 1,
                "prints": 1,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 82434
        }
    }
}