General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A1H7XZP2",
        "id": "A0A1H7XZP2_9SPHN",
        "source_organism": {
            "taxId": "1166340",
            "scientificName": "Sphingomonas gellani",
            "fullName": "Sphingomonas gellani"
        },
        "name": "Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE",
        "description": [
            "Methyltransferase required for the conversion of demethylmenaquinol (DMKH2) to menaquinol (MKH2) and the conversion of 2-polyprenyl-6-methoxy-1,4-benzoquinol (DDMQH2) to 2-polyprenyl-3-methyl-6-methoxy-1,4-benzoquinol (DMQH2)"
        ],
        "length": 243,
        "sequence": "MTDTVYFGYQDVAPEEKTRRVGGVFTSVASRYDLMNDAMSGGMHRLWKDRFVRRVKPRAGEQVLDMAGGTGDIAFRLARSGASITVADINPAMLAVGMERAQKRGIDGLVWSEANAETLTYPDRFFDAYTIAFGIRNVTDIPKALREAHRVLRRGGRFFCLEFSTNQWPGFSDVYDAYSHKLVPKVGQLLAGDADSYRYLIESIRRFPDMPTFEGMIRDAGFVNTRVEPILGGLVAIHSGWKI",
        "proteome": "UP000199206",
        "gene": "ubiE",
        "go_terms": [
            {
                "identifier": "GO:0008168",
                "name": "methyltransferase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "5ac5548d5e504575f3d15712f6008650ab117a55",
        "counters": {
            "domain_architectures": 29373,
            "entries": 13,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "profile": 1,
                "cathgene3d": 1,
                "cdd": 1,
                "hamap": 1,
                "panther": 1,
                "pfam": 1,
                "ncbifam": 1,
                "prosite": 2,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 29373
        }
    }
}