GET /api/protein/UniProt/A0A1G8WRZ8/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A1G8WRZ8",
        "id": "A0A1G8WRZ8_9EURY",
        "source_organism": {
            "taxId": "2200",
            "scientificName": "Methanoculleus thermophilus",
            "fullName": "Methanoculleus thermophilus"
        },
        "name": "Translation initiation factor 2 subunit gamma",
        "description": [
            "eIF-2 functions in the early steps of protein synthesis by forming a ternary complex with GTP and initiator tRNA"
        ],
        "length": 411,
        "sequence": "MRDVFIPSVNIGLVGHVDHGKTTLVSALTGTWTDRHSEEIKRGISIRLGYADTTFYKCEECEGAEAYTTKPECPICGKKAVPFRTVSFVDAPGHETLMATMLSGSALMDGAMLVIAANEACPQPQTKEHLMALELIGIKKIVIVQNKIDVVTQAEALEHYKQIKRFIKGTIAEDAPIIPVSAQKGINIGALIQALNEVIPEPERDPEVNPLMLIARSFDINKPGCSWREIKGGVIGGSLIRGVLHEGDDIEIRPGRQVQIENRTKWEPIETKITSIHAGKTKVTEAAPGGLLGVGTKLDPALTKSDALAGQVAGLVGKLPPIWERMTFEVTLMDRVVGADSELLIEPLKHKEPLMLSVGTAVTVGVITNTKKNLVEVMLKRAVCAEVGARIAISRQVGGRWRLIGMGVLVE",
        "proteome": "UP000326500",
        "gene": "eif2g",
        "go_terms": [
            {
                "identifier": "GO:0003924",
                "name": "GTPase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0005525",
                "name": "GTP binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0000049",
                "name": "tRNA binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "2c7b8103bc7d24a083ed77bc5ceec0570a6af3cf",
        "counters": {
            "domain_architectures": 4365,
            "entries": 29,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 6,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "profile": 1,
                "cathgene3d": 2,
                "pfam": 3,
                "ssf": 3,
                "ncbifam": 3,
                "cdd": 3,
                "hamap": 1,
                "panther": 1,
                "prints": 1,
                "interpro": 11
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 4365
        }
    }
}