HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A1G8WRZ8",
"id": "A0A1G8WRZ8_9EURY",
"source_organism": {
"taxId": "2200",
"scientificName": "Methanoculleus thermophilus",
"fullName": "Methanoculleus thermophilus"
},
"name": "Translation initiation factor 2 subunit gamma",
"description": [
"eIF-2 functions in the early steps of protein synthesis by forming a ternary complex with GTP and initiator tRNA"
],
"length": 411,
"sequence": "MRDVFIPSVNIGLVGHVDHGKTTLVSALTGTWTDRHSEEIKRGISIRLGYADTTFYKCEECEGAEAYTTKPECPICGKKAVPFRTVSFVDAPGHETLMATMLSGSALMDGAMLVIAANEACPQPQTKEHLMALELIGIKKIVIVQNKIDVVTQAEALEHYKQIKRFIKGTIAEDAPIIPVSAQKGINIGALIQALNEVIPEPERDPEVNPLMLIARSFDINKPGCSWREIKGGVIGGSLIRGVLHEGDDIEIRPGRQVQIENRTKWEPIETKITSIHAGKTKVTEAAPGGLLGVGTKLDPALTKSDALAGQVAGLVGKLPPIWERMTFEVTLMDRVVGADSELLIEPLKHKEPLMLSVGTAVTVGVITNTKKNLVEVMLKRAVCAEVGARIAISRQVGGRWRLIGMGVLVE",
"proteome": "UP000326500",
"gene": "eif2g",
"go_terms": [
{
"identifier": "GO:0003924",
"name": "GTPase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0005525",
"name": "GTP binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0000049",
"name": "tRNA binding",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "2c7b8103bc7d24a083ed77bc5ceec0570a6af3cf",
"counters": {
"domain_architectures": 4365,
"entries": 29,
"isoforms": 0,
"proteomes": 1,
"sets": 6,
"structures": 0,
"taxa": 1,
"dbEntries": {
"profile": 1,
"cathgene3d": 2,
"pfam": 3,
"ssf": 3,
"ncbifam": 3,
"cdd": 3,
"hamap": 1,
"panther": 1,
"prints": 1,
"interpro": 11
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 4365
}
}
}