HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A1F8DH92",
"id": "A0A1F8DH92_9BACT",
"source_organism": {
"taxId": "1802549",
"scientificName": "Candidatus Woesebacteria bacterium RIFOXYD1_FULL_40_21",
"fullName": "Candidatus Woesebacteria bacterium RIFOXYD1_FULL_40_21"
},
"name": "Aspartate--tRNA(Asp/Asn) ligase",
"description": [
"Aspartyl-tRNA synthetase with relaxed tRNA specificity since it is able to aspartylate not only its cognate tRNA(Asp) but also tRNA(Asn). Reaction proceeds in two steps: L-aspartate is first activated by ATP to form Asp-AMP and then transferred to the acceptor end of tRNA(Asp/Asn)"
],
"length": 463,
"sequence": "MERTLAIETISKIGKKVKLAGWVNSIRDHGKITFIDLRDRSGIVQGVGENLPKVTSESVIEMVGEVKARPKNLINPKIETGKVEVQIEKIEIITQASELPIPIDSDGYDIDEDIRNKYRYLDLRRPRMARNVRIRSKVAQFMRNWLTARDFVEIETPILTKTTPEGARDFLVPSRLQKGKFYALPQSPQQYKQLLMVAGFERYFQLARCFRDEDPRKDRAYGEFTQLDLEMSYVTQEDILNLTEELFTELVKEIFPKKKISQTPWPRIPHKEALKKYGNDKPDLRKDKNDPDELAFAWTIDFPLFTKQTKEDFYYGSGSAKFAPSHHMFTAPHPEDVPLLDSDPSRVRGLQHDLVLNGYEVGGGSIRIHDPKIQTKIFELIGFSEEQKKGFEHMLTAFKYGVPPHGGIAPGVDRFVFVVLGEPSIREVMAYPASASGQIAVMDAPSEATEAQLKELGLKVIEK",
"proteome": null,
"gene": "aspS",
"go_terms": [
{
"identifier": "GO:0003676",
"name": "nucleic acid binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0000166",
"name": "nucleotide binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0004812",
"name": "aminoacyl-tRNA ligase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0005524",
"name": "ATP binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006418",
"name": "tRNA aminoacylation for protein translation",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0016874",
"name": "ligase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "6ac43a766b5e2c881b797b6376f1d61a8f0603a0",
"counters": {
"domain_architectures": 52467,
"entries": 21,
"isoforms": 0,
"proteomes": 0,
"sets": 4,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 2,
"cdd": 2,
"ssf": 2,
"pfam": 2,
"profile": 1,
"hamap": 1,
"panther": 1,
"prints": 1,
"interpro": 9
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 52467
}
}
}