GET /api/protein/UniProt/A0A1F8DH92/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A1F8DH92",
        "id": "A0A1F8DH92_9BACT",
        "source_organism": {
            "taxId": "1802549",
            "scientificName": "Candidatus Woesebacteria bacterium RIFOXYD1_FULL_40_21",
            "fullName": "Candidatus Woesebacteria bacterium RIFOXYD1_FULL_40_21"
        },
        "name": "Aspartate--tRNA(Asp/Asn) ligase",
        "description": [
            "Aspartyl-tRNA synthetase with relaxed tRNA specificity since it is able to aspartylate not only its cognate tRNA(Asp) but also tRNA(Asn). Reaction proceeds in two steps: L-aspartate is first activated by ATP to form Asp-AMP and then transferred to the acceptor end of tRNA(Asp/Asn)"
        ],
        "length": 463,
        "sequence": "MERTLAIETISKIGKKVKLAGWVNSIRDHGKITFIDLRDRSGIVQGVGENLPKVTSESVIEMVGEVKARPKNLINPKIETGKVEVQIEKIEIITQASELPIPIDSDGYDIDEDIRNKYRYLDLRRPRMARNVRIRSKVAQFMRNWLTARDFVEIETPILTKTTPEGARDFLVPSRLQKGKFYALPQSPQQYKQLLMVAGFERYFQLARCFRDEDPRKDRAYGEFTQLDLEMSYVTQEDILNLTEELFTELVKEIFPKKKISQTPWPRIPHKEALKKYGNDKPDLRKDKNDPDELAFAWTIDFPLFTKQTKEDFYYGSGSAKFAPSHHMFTAPHPEDVPLLDSDPSRVRGLQHDLVLNGYEVGGGSIRIHDPKIQTKIFELIGFSEEQKKGFEHMLTAFKYGVPPHGGIAPGVDRFVFVVLGEPSIREVMAYPASASGQIAVMDAPSEATEAQLKELGLKVIEK",
        "proteome": null,
        "gene": "aspS",
        "go_terms": [
            {
                "identifier": "GO:0003676",
                "name": "nucleic acid binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0000166",
                "name": "nucleotide binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0004812",
                "name": "aminoacyl-tRNA ligase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0005524",
                "name": "ATP binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006418",
                "name": "tRNA aminoacylation for protein translation",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0016874",
                "name": "ligase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "6ac43a766b5e2c881b797b6376f1d61a8f0603a0",
        "counters": {
            "domain_architectures": 52467,
            "entries": 21,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 4,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 2,
                "cdd": 2,
                "ssf": 2,
                "pfam": 2,
                "profile": 1,
                "hamap": 1,
                "panther": 1,
                "prints": 1,
                "interpro": 9
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 52467
        }
    }
}