General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A1F7ZX29",
        "id": "A0A1F7ZX29_9EURO",
        "source_organism": {
            "taxId": "109264",
            "scientificName": "Aspergillus bombycis",
            "fullName": "Aspergillus bombycis"
        },
        "name": "Endo-chitosanase",
        "description": [
            "Chitosanase catalyzing the endo-type cleavage of chitosan, the deacylated form of chitin. Chitosanase may be crucial in the degradation of the deacetylated portion of chitin in the fungal cell wall"
        ],
        "length": 241,
        "sequence": "MRLSEILAVALVTGATAYDLPDNLKQIYEKHKGKCSNVLESGFTNGGHSDGKSFEYCGDIEGAIFMHSSAKGGLYTNMDVDCDGANNSAGKCSNDPSGQDVTAFKDEVKKFGIPDLDANLHPYIVFGNEEHSPKFKPQKHGMEPLSVMAVVCNGKLHYGIWGDTNGGTSTGEASLSMAELCFPEENPDGDHGHDDNDVLYIGFTGKDAVPGKSANWKAKKTEDFEDSIKSIGDKLVAGLKA",
        "proteome": "UP000179179",
        "gene": "ABOM_008012",
        "go_terms": [
            {
                "identifier": "GO:0016977",
                "name": "chitosanase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "c715981d5b713b2a0c29620ac512a78a508c4541",
        "counters": {
            "domain_architectures": 2356,
            "entries": 3,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "panther": 1,
                "pfam": 1,
                "interpro": 1
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 2356
        }
    }
}