GET /api/protein/UniProt/A0A1F7ZUI7/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A1F7ZUI7",
"id": "A0A1F7ZUI7_9EURO",
"source_organism": {
"taxId": "109264",
"scientificName": "Aspergillus bombycis",
"fullName": "Aspergillus bombycis"
},
"name": "40S ribosomal protein S21",
"description": [
"Required for the processing of the 20S rRNA-precursor to mature 18S rRNA in a late step of the maturation of 40S ribosomal subunits. Has a physiological role leading to 18S rRNA stability"
],
"length": 86,
"sequence": "MENEKGEIVDLYVPRKCSATNRIIKANDHASVQISIGKVDENGRYTGENQTYALCGFIRARGESDDSLNRLTQRDGYLRNVWTASR",
"proteome": "UP000179179",
"gene": "ABOM_008204",
"go_terms": [
{
"identifier": "GO:0003735",
"name": "structural constituent of ribosome",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006412",
"name": "translation",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0005840",
"name": "ribosome",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "46fe84434190a5585075fa61821a0abc56a783af",
"counters": {
"domain_architectures": 5083,
"entries": 8,
"isoforms": 0,
"proteomes": 1,
"sets": 0,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"pfam": 1,
"panther": 1,
"pirsf": 1,
"prosite": 1,
"interpro": 3
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 5083
}
}
}