GET /api/protein/UniProt/A0A1D9MFV9/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A1D9MFV9",
        "id": "A0A1D9MFV9_9RHOB",
        "source_organism": {
            "taxId": "1850250",
            "scientificName": "Rhodobacter xanthinilyticus",
            "fullName": "Rhodobacter xanthinilyticus"
        },
        "name": "Methionyl-tRNA formyltransferase",
        "description": [
            "Attaches a formyl group to the free amino group of methionyl-tRNA(fMet). The formyl group appears to play a dual role in the initiator identity of N-formylmethionyl-tRNA by promoting its recognition by IF2 and preventing the misappropriation of this tRNA by the elongation apparatus"
        ],
        "length": 298,
        "sequence": "MRVVFMGTPDFSVPVLETLHAEHEIVAVYSQPPRPAGRGKKERPSPVHARALELGLAVRTPVNFKQTETREAFAALGADVAVVVAYGLILPQAILDAPRKGCLNIHASLLPRWRGAAPIHRAIMSGDAATGVCIMQMEAGLDTGPVLLREETTIGASETTGELHDRLSAMGARLIVQALARIDALTPEAQPSEGVTYAQKIDKAEAHVDWTEAAEEVCRKINGLSPFPGAWTEIDGERIKLLRAEVLDSEGAAGTTAEAFVVYCGTGAVRVLEAQREGKRPMPTTELLKGLTLPASLI",
        "proteome": "UP000176562",
        "gene": "fmt",
        "go_terms": [
            {
                "identifier": "GO:0009058",
                "name": "biosynthetic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0004479",
                "name": "methionyl-tRNA formyltransferase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0003824",
                "name": "catalytic activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0071951",
                "name": "conversion of methionyl-tRNA to N-formyl-methionyl-tRNA",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "263553189fd17f2554dea1d9646cd1ac999dfb46",
        "counters": {
            "domain_architectures": 32658,
            "entries": 19,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "pfam": 2,
                "cdd": 2,
                "ssf": 2,
                "cathgene3d": 1,
                "panther": 1,
                "ncbifam": 1,
                "hamap": 1,
                "prosite": 1,
                "interpro": 8
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 32658
        }
    }
}