HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A1D8FZ99",
"id": "A0A1D8FZ99_9ACTN",
"source_organism": {
"taxId": "285473",
"scientificName": "Streptomyces rubrolavendulae",
"fullName": "Streptomyces rubrolavendulae"
},
"name": "Probable cytochrome c oxidase subunit 2",
"description": [
"Subunits I and II form the functional core of the enzyme complex. Electrons originating in cytochrome c are transferred via heme a and Cu(A) to the binuclear center formed by heme a3 and Cu(B)"
],
"length": 322,
"sequence": "MSPNGSDRSSRRPMRRKLPQVLTAGLILATASGCSYNWEDFPRLGMPTPVTEEAPRILSLWQGSWAAALATGVLVWGLILWSVIFHRRSRTKVEVPPQTRYNMPIEALYTVTPLIIVSVLFYFTARDESKLLALSDKPAHTINVVGYQWSWGFNYIENVDGDAATGAEVPKELGAVPDKWQKQFPAGAEGVHDFGIPGTRNPQTGNPGPTLWLPKGEKVRFVLTSRDVIHSFWVVPFLMKQDVIPGHTNAFEVTPTQEGTFLGKCAELCGVDHSRMLFNVKVVSPERYQQHLKELAEKGQTGYIPSGIEQTDPARNAEKNQL",
"proteome": "UP000095349",
"gene": "ctaC",
"go_terms": [
{
"identifier": "GO:0004129",
"name": "cytochrome-c oxidase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0005507",
"name": "copper ion binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0016020",
"name": "membrane",
"category": {
"code": "C",
"name": "cellular_component"
}
},
{
"identifier": "GO:0016491",
"name": "oxidoreductase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "88b60944f2de6b5d45ece24636a695a26d91384e",
"counters": {
"domain_architectures": 14503,
"entries": 18,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 2,
"cathgene3d": 2,
"profile": 1,
"cdd": 1,
"pfam": 1,
"ncbifam": 2,
"panther": 1,
"prosite": 1,
"prints": 1,
"interpro": 6
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 14503
}
}
}