GET /api/protein/UniProt/A0A1D7TSE0/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A1D7TSE0",
        "id": "A0A1D7TSE0_9LACO",
        "source_organism": {
            "taxId": "1624",
            "scientificName": "Ligilactobacillus salivarius",
            "fullName": "Ligilactobacillus salivarius"
        },
        "name": "D-alanyl carrier protein",
        "description": [
            "Carrier protein involved in the D-alanylation of lipoteichoic acid (LTA). The loading of thioester-linked D-alanine onto DltC is catalyzed by D-alanine--D-alanyl carrier protein ligase DltA. The DltC-carried D-alanyl group is further transferred to cell membrane phosphatidylglycerol (PG) by forming an ester bond, probably catalyzed by DltD. D-alanylation of LTA plays an important role in modulating the properties of the cell wall in Gram-positive bacteria, influencing the net charge of the cell wall"
        ],
        "length": 75,
        "sequence": "MKDTVLDILEDLTGSDEVKKDLDVNLFETGLLDSMATVQLLLELQTQLGVDVPVSEFERSEWDTPNKIIAKVENN",
        "proteome": null,
        "gene": "dltC",
        "go_terms": [
            {
                "identifier": "GO:0036370",
                "name": "D-alanyl carrier activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0019350",
                "name": "teichoic acid biosynthetic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "3c9e8d520e54d5947b224319c71493893473a1da",
        "counters": {
            "domain_architectures": 82947,
            "entries": 10,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "profile": 1,
                "ssf": 1,
                "pfam": 1,
                "ncbifam": 2,
                "hamap": 1,
                "interpro": 3
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 82947
        }
    }
}