GET /api/protein/UniProt/A0A1C4DLG0/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A1C4DLG0",
"id": "A0A1C4DLG0_9ENTR",
"source_organism": {
"taxId": "1005665",
"scientificName": "Kosakonia oryzendophytica",
"fullName": "Kosakonia oryzendophytica"
},
"name": "Met repressor",
"description": [
"This regulatory protein, when combined with SAM (S-adenosylmethionine) represses the expression of the methionine regulon and of enzymes involved in SAM synthesis"
],
"length": 105,
"sequence": "MAEWSGEYISPYAEHGKKSEQVKKITVSIPLKVLKILTDERTRRQVNNLRHATNSELLCEAFLHAFTGQPLPNDEDLRKERSDEIPEEAKVIMRELGIDPDTWEY",
"proteome": "UP000198975",
"gene": "metJ",
"go_terms": [
{
"identifier": "GO:0003700",
"name": "DNA-binding transcription factor activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006355",
"name": "regulation of DNA-templated transcription",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0006555",
"name": "methionine metabolic process",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "19d53d712b344eb4960aeee4e25a4c7a80d742db",
"counters": {
"domain_architectures": 1990,
"entries": 9,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cdd": 1,
"ssf": 1,
"cathgene3d": 1,
"pfam": 1,
"hamap": 1,
"ncbifam": 1,
"interpro": 3
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 1990
}
}
}