General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A1C1CM15",
        "id": "A0A1C1CM15_9EURO",
        "source_organism": {
            "taxId": "86049",
            "scientificName": "Cladophialophora carrionii",
            "fullName": "Cladophialophora carrionii"
        },
        "name": "protein-serine/threonine phosphatase",
        "description": [
            "Component of the cleavage and polyadenylation factor (CPF) complex, which plays a key role in polyadenylation-dependent pre-mRNA 3'-end formation and cooperates with cleavage factors including the CFIA complex and NAB4/CFIB. SSU72 is required for 3'-end formation of snoRNAs"
        ],
        "length": 322,
        "sequence": "MSVDPRRARLQARTQTPQPAASISQAPPAPPVASAPVPAEPPVQPGPTTSPFLDGSVDSPPTAAAPLTASAPAPLEAPSSTNDVPFKLKFCTVCASNNNRSMEAHLRLSTSSHAYPVISFGTGSYVRLPGPSISQPQVYNFNTTSYTKMYEELNAQDARLYRNNGILNMLDRNRKIKWGPERFHDWVIGNPRMEALSRGDKGAMGAEGGVVDVIFTCEERCWDAVVDNLLDRGAPLNRPVHVFNIDIKDNHEEALVGGGAILELADSLNEAAIQERKISGTQGWENGTGAARMSFDEKVPEILARWQERWPNLPALWTLSWF",
        "proteome": "UP000094526",
        "gene": "ssu72",
        "go_terms": [
            {
                "identifier": "GO:0004721",
                "name": "phosphoprotein phosphatase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006397",
                "name": "mRNA processing",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0005634",
                "name": "nucleus",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "6a02e70ccac1a6e2e8151473d344ffcc5b9fb6f5",
        "counters": {
            "domain_architectures": 4480,
            "entries": 4,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "panther": 1,
                "pfam": 1,
                "interpro": 1
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 4480
        }
    }
}