GET /api/protein/UniProt/A0A1B6Q1P0/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A1B6Q1P0",
"id": "A0A1B6Q1P0_SORBI",
"source_organism": {
"taxId": "4558",
"scientificName": "Sorghum bicolor",
"fullName": "Sorghum bicolor (Sorghum)"
},
"name": "Pulmonary surfactant-associated protein B",
"description": [
"Pulmonary surfactant-associated proteins promote alveolar stability by lowering the surface tension at the air-liquid interface in the peripheral air spaces. SP-B increases the collapse pressure of palmitic acid to nearly 70 millinewtons per meter"
],
"length": 219,
"sequence": "MCSITRLAFVLALAIASSTEVAESRDFNILAKGPGLTAASGKLCQLCEQYSTEALFYLTQNETQTEILSILHHECASLAPLKQQCITLVDYYIPLFFFEVSMVTPEKFCESMHLCKNGMKISLPTREGTCGLCHHVVVEVLVMLKDPNTQLEVIDLLNKTCSKAQNYEQQCKQLVLKYIPLILVKGEKFLETTDVCSAIHACKAGTQASMETMPLSATL",
"proteome": "UP000000768",
"gene": "SORBI_3003G055700",
"go_terms": [
{
"identifier": "GO:0006629",
"name": "lipid metabolic process",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 4,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "ac42d281e5e53ef98ed8f3ce7c444123feb02fe0",
"counters": {
"domain_architectures": 652,
"entries": 12,
"isoforms": 0,
"proteomes": 1,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"profile": 1,
"ssf": 1,
"smart": 1,
"pfam": 2,
"panther": 1,
"interpro": 5
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 652
}
}
}