GET /api/protein/UniProt/A0A1B6Q1P0/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A1B6Q1P0",
        "id": "A0A1B6Q1P0_SORBI",
        "source_organism": {
            "taxId": "4558",
            "scientificName": "Sorghum bicolor",
            "fullName": "Sorghum bicolor (Sorghum)"
        },
        "name": "Pulmonary surfactant-associated protein B",
        "description": [
            "Pulmonary surfactant-associated proteins promote alveolar stability by lowering the surface tension at the air-liquid interface in the peripheral air spaces. SP-B increases the collapse pressure of palmitic acid to nearly 70 millinewtons per meter"
        ],
        "length": 219,
        "sequence": "MCSITRLAFVLALAIASSTEVAESRDFNILAKGPGLTAASGKLCQLCEQYSTEALFYLTQNETQTEILSILHHECASLAPLKQQCITLVDYYIPLFFFEVSMVTPEKFCESMHLCKNGMKISLPTREGTCGLCHHVVVEVLVMLKDPNTQLEVIDLLNKTCSKAQNYEQQCKQLVLKYIPLILVKGEKFLETTDVCSAIHACKAGTQASMETMPLSATL",
        "proteome": "UP000000768",
        "gene": "SORBI_3003G055700",
        "go_terms": [
            {
                "identifier": "GO:0006629",
                "name": "lipid metabolic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 4,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "ac42d281e5e53ef98ed8f3ce7c444123feb02fe0",
        "counters": {
            "domain_architectures": 652,
            "entries": 12,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "profile": 1,
                "ssf": 1,
                "smart": 1,
                "pfam": 2,
                "panther": 1,
                "interpro": 5
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 652
        }
    }
}