GET /api/protein/UniProt/A0A1B2LVH9/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A1B2LVH9",
        "id": "A0A1B2LVH9_9GAMM",
        "source_organism": {
            "taxId": "1789224",
            "scientificName": "Acinetobacter larvae",
            "fullName": "Acinetobacter larvae"
        },
        "name": "16S rRNA (cytosine(967)-C(5))-methyltransferase",
        "description": [
            "Specifically methylates the cytosine at position 967 (m5C967) of 16S rRNA"
        ],
        "length": 434,
        "sequence": "MNQPLSSSKRNLRAQLVTSLLAVQQGRSLQSILSHELAQVPSKDRALFHELLLGTLRQWHALKNISLPLLSKPLNNPTVESCIYLGMYQLLMTRTAPHAAISETVEACKQLGFAALSGVVNAILRRVSRETEAFQQALNATHGLPSWLAKRLKRDWPEHFPALCQQLKQPTSICLRINQRKIGRDAYLTLLHAQDIAAHAVSWIESAIVLDQNVQITSLPGFEKGWFAVQDLHAQLASQLLCALDQKVVLDACAAPGGKTAHLLEKYIPKQLIAIDSDEQRLQRVQENLTRLALHEIAPLSIQCADATTWQAEQLLDAILLDAPCSATGVLRRHPDIRLLRQSSDIEPIVQLQSQILEQLWSQLKVGGQLLYITCSILKAENEQQMQNFFAKHADAQEIKIAADWGIAQQYGRQLLPLEAYGDGFYYCLISKIA",
        "proteome": "UP000093391",
        "gene": "BFG52_00165",
        "go_terms": [
            {
                "identifier": "GO:0003723",
                "name": "RNA binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006355",
                "name": "regulation of DNA-templated transcription",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0008168",
                "name": "methyltransferase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0008649",
                "name": "rRNA methyltransferase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006364",
                "name": "rRNA processing",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0008173",
                "name": "RNA methyltransferase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0001510",
                "name": "RNA methylation",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "a72c2197e94c34f15eada742d0b3b63463a231c3",
        "counters": {
            "domain_architectures": 12231,
            "entries": 22,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 4,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 3,
                "pfam": 3,
                "ssf": 2,
                "profile": 1,
                "cdd": 1,
                "ncbifam": 2,
                "panther": 1,
                "prints": 1,
                "interpro": 8
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 12231
        }
    }
}