HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A1B2LVH9",
"id": "A0A1B2LVH9_9GAMM",
"source_organism": {
"taxId": "1789224",
"scientificName": "Acinetobacter larvae",
"fullName": "Acinetobacter larvae"
},
"name": "16S rRNA (cytosine(967)-C(5))-methyltransferase",
"description": [
"Specifically methylates the cytosine at position 967 (m5C967) of 16S rRNA"
],
"length": 434,
"sequence": "MNQPLSSSKRNLRAQLVTSLLAVQQGRSLQSILSHELAQVPSKDRALFHELLLGTLRQWHALKNISLPLLSKPLNNPTVESCIYLGMYQLLMTRTAPHAAISETVEACKQLGFAALSGVVNAILRRVSRETEAFQQALNATHGLPSWLAKRLKRDWPEHFPALCQQLKQPTSICLRINQRKIGRDAYLTLLHAQDIAAHAVSWIESAIVLDQNVQITSLPGFEKGWFAVQDLHAQLASQLLCALDQKVVLDACAAPGGKTAHLLEKYIPKQLIAIDSDEQRLQRVQENLTRLALHEIAPLSIQCADATTWQAEQLLDAILLDAPCSATGVLRRHPDIRLLRQSSDIEPIVQLQSQILEQLWSQLKVGGQLLYITCSILKAENEQQMQNFFAKHADAQEIKIAADWGIAQQYGRQLLPLEAYGDGFYYCLISKIA",
"proteome": "UP000093391",
"gene": "BFG52_00165",
"go_terms": [
{
"identifier": "GO:0003723",
"name": "RNA binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006355",
"name": "regulation of DNA-templated transcription",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0008168",
"name": "methyltransferase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0008649",
"name": "rRNA methyltransferase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006364",
"name": "rRNA processing",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0008173",
"name": "RNA methyltransferase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0001510",
"name": "RNA methylation",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "a72c2197e94c34f15eada742d0b3b63463a231c3",
"counters": {
"domain_architectures": 12231,
"entries": 22,
"isoforms": 0,
"proteomes": 1,
"sets": 4,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 3,
"pfam": 3,
"ssf": 2,
"profile": 1,
"cdd": 1,
"ncbifam": 2,
"panther": 1,
"prints": 1,
"interpro": 8
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 12231
}
}
}